KEGG   Shewanella oneidensis: SO_1198Help
Entry
SO_1198           CDS       T00099                                 

Gene name
folP
Definition
dihydropteroate synthase FolP (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
son  Shewanella oneidensis
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:son00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1241974..1242807
Genome map
AA seq 277 aa AA seqDB search
MFELISGTKRLSLASPVVMGILNVTPDSFSDGGKFSSFELACQHADEMVAQGALIIDIGG
ESTRPGAADVGVEDELARVIPLVEYVAKHHDVWISVDTSKPEVMRQAVNAGAHLINDVRA
LLEPGALETAAQLNVPICLMHMQGAPRTMQAAPEYHDLVADVSEFLNERIQACLEAGIPR
ERLLIDPGFGFGKTLAHNYELLAKLETFTQFELPILIGLSRKSMIGNLLARPTSERLAGS
LAGAMIAAQKGAHIIRVHDVPETVDMLKVLQATQAYY
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
gtgtttgaattaatttctggaaccaaacgcttatccttagcttcgcccgtagtgatgggc
attctgaatgtcactcccgattctttttccgacggtggaaagttctcttcctttgaatta
gcttgccagcatgccgatgagatggtcgctcaaggagcgctcatcattgatatcggcggc
gagtcaacaagaccaggggcggctgatgtcggcgttgaggatgagctcgctcgtgtgatc
ccgctggtagagtatgttgccaaacaccatgatgtgtggatttcggtcgataccagtaag
cccgaagtgatgcgacaggcggtgaatgccggtgcccatttaattaatgatgttcgcgcg
ttattggagcctggtgcattagagactgcggcgcagctgaatgtacctatatgtttgatg
cacatgcagggagcgccacgcactatgcaagcggcacccgaatatcacgacctagttgct
gatgtctctgaattcctaaacgagcgtattcaagcctgtctcgaggcagggatcccgcgg
gagcggttgttaatcgacccaggcttcggctttggtaaaactttagcgcataactatgaa
ttgctagcaaagttagagacttttactcagtttgaactgccaatcttgataggtttatcc
cgtaagagcatgataggaaatcttcttgctaggccgacctccgagcgccttgcgggaagc
cttgctggcgctatgatagcggcccagaaaggggcacatatcattcgtgtccatgatgtc
cctgaaacagttgatatgctcaaagtgttacaagcgacacaggcatattactag

DBGET integrated database retrieval system