KEGG   Shewanella oneidensis: SO_1200Help
Entry
SO_1200           CDS       T00099                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomeraseTpiA
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
son  Shewanella oneidensis
Pathway
son00010  Glycolysis / Gluconeogenesis
son00051  Fructose and mannose metabolism
son00562  Inositol phosphate metabolism
son01100  Metabolic pathways
son01110  Biosynthesis of secondary metabolites
son01120  Microbial metabolism in diverse environments
son01130  Biosynthesis of antibiotics
son01200  Carbon metabolism
son01230  Biosynthesis of amino acids
Module
son_M00002  Glycolysis, core module involving three-carbon compounds
son_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:son00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SO_1200 (tpiA)
   00051 Fructose and mannose metabolism
    SO_1200 (tpiA)
   00562 Inositol phosphate metabolism
    SO_1200 (tpiA)
Enzymes [BR:son01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SO_1200 (tpiA)
Exosome [BR:son04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SO_1200 (tpiA)
  Exosomal proteins of bladder cancer cells
   SO_1200 (tpiA)
  Exosomal proteins of melanoma cells
   SO_1200 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-GeneID: 1169028
NCBI-ProteinID: NP_716825
UniProt: Q8EHL9
Position
1244412..1245194
Genome map
AA seq 260 aa AA seqDB search
MALRRPMVAGNWKMNGSAALAQELFKKFASKLQNDSAEVVLCPPSIYLESVRQLLEANKE
ALDGSLVRMGAQNLSQHDFGAYTGEVSGQMLKDCGCRYVIIGHSERRRMYGETSNIVAEK
FAAAQKHGLTPILCVGESGPAREARRTFEVIAEELDIVIQKNGTMAFDNAIIAYEPLWAV
GTGKSATPEQAQEVHAFIRKRLSEVSPFIGENIRILYGGSVTPSNAADLFAQPDVDGGLI
GGASLNSTEFLSLCTIAMSA
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggcactcagacgtcctatggtagctggcaattggaagatgaacggcagtgcggcatta
gcccaagagttgttcaagaaatttgcctcaaagctccaaaatgattcagctgaagtggtt
ttatgcccgccttctatctatctagaaagcgtcaggcaactgctagaagcaaacaaggaa
gcgttagacggttcacttgttaggatgggcgcacagaatttaagtcagcatgactttggc
gcttataccggagaagtttcgggtcagatgcttaaagattgcggatgtcgatatgttatt
atcgggcattcagaacgtcgccgtatgtacggagagacgagtaatattgtagcggagaaa
ttcgctgcagcacaaaagcacggcttaacccctattttatgtgtgggagagtcgggtcca
gcacgagaagcaagacgtacttttgaggtgattgctgaagagttggacatagtgatccaa
aaaaatggcactatggcttttgataacgccattatcgcttacgagccattatgggcagta
ggaactggtaagagcgctacaccagagcaggcgcaagaagttcatgcgtttattcgcaaa
cgtctctctgaagtgtctccatttattggggaaaatatcaggattctctacggtggaagt
gtgacaccgagtaacgcggcagatttatttgcccaacctgatgttgatggtggactgatt
ggcggtgccagtttaaactctaccgagtttttaagtctgtgtaccatagcgatgagcgca
taa

DBGET integrated database retrieval system