KEGG   Shewanella oneidensis: SO_1218Help
Entry
SO_1218           CDS       T00099                                 

Gene name
deoA
Definition
thymidine phosphorylase DeoA (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
son  Shewanella oneidensis
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:son00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1264752..1266083
Genome map
AA seq 443 aa AA seqDB search
MFLAQEIIRKKRNGLVLSAEEIQFFVKGITTNAVSEGQIAALGMAVYFNDMNMDERIALT
TAMRDSGTVLNWQSLNLNGPVIDKHSTGGVGDVISLMLGPMAAACGGYVPMISGRGLGHT
GGTLDKFDAIPGYQTEPSSELFRKVVKDVGVAIIGQTGDLVPADKRFYSIRDNTATVESI
SLITASILSKKLACSLDALAMDVKVGSGAFMPTYEASEELARSIAAVANGAGTKTTALLT
DMNQVLASCAGNALEVKEAIDFLTGAYRNPRLYAVTMGLCAEMLLLGGLATDEADARAKL
NRVLDNGRAAEIFGKMVSGLGGPVDFVENYSKYLPQSQIIRPVFADTQGYAHSMDTRELG
LAVVTLGGGRRKPGDELDYSVGLTQVCALGDKIDASTPIAVIHAQSEEAFAQAEDAVKKA
IHIDEIAPEKTPEIYAYIRATDL
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgtttctagctcaagaaattatacgtaagaaacgcaatgggttagtcttaagtgccgaa
gagatacagttcttcgttaagggcataaccaccaatgcagtgtcggaaggacagatcgcc
gcattaggcatggcagtgtattttaatgacatgaatatggatgaaagaatcgctttgacc
acggcaatgcgcgattctggcactgtactcaattggcaatcactcaatcttaatggccct
gttatcgataaacacagcactggtggtgtcggtgatgtgattagtcttatgctcggcccc
atggcggctgcttgtggtggctatgtaccgatgatttcgggtcgtggcctcggtcatact
ggcggtacgctcgataagtttgatgcaattcccggttaccaaactgaaccttcgagtgaa
ttgttccgcaaagtggtaaaagatgtcggtgtggcgattattgggcaaactggtgatctc
gtccccgccgataaacgtttctactccatccgtgacaacactgctaccgtcgaatccatc
tccctcattaccgcctctattctctctaagaaattagcttgtagtctcgatgcattggcg
atggacgtcaaagtcggtagtggcgcatttatgccgacttacgaagcctctgaagagctt
gctcgcagcatcgctgcggtagccaatggcgctggcactaaaaccacagctttactcacc
gacatgaaccaagtattagcttcatgtgcgggtaatgcacttgaagtaaaagaagccatc
gacttcttaaccggcgcttaccgtaatcctcgtctttacgctgtgactatggggctttgt
gccgagatgttactcctaggtggcctagctaccgatgaagcggatgcccgtgccaagtta
aaccgcgtattagataacggccgcgctgccgagatcttcggcaagatggtttctggcctc
ggcggtcccgttgattttgtcgaaaattacagtaagtacttaccgcaatcgcaaattatt
cgtccggtatttgccgatactcaaggttatgctcacagcatggatacccgtgagcttggt
ttagccgtggtgaccttaggtggcggccgccgtaaacctggtgatgagctagactacagt
gttggtctgactcaagtgtgtgccctaggtgataagattgatgcttctacaccgattgca
gtgatccacgcgcaatccgaagaagcctttgcgcaggccgaagacgcggtgaaaaaagcg
attcatattgatgaaatcgctccagaaaaaacacctgagatctatgcttatattcgagca
acggatctttaa

DBGET integrated database retrieval system