KEGG   Shewanella oneidensis: SO_1292Help
Entry
SO_1292           CDS       T00099                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase FolK-like protein (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
son  Shewanella oneidensis
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:son00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1342607..1343110
Genome map
AA seq 167 aa AA seqDB search
MARIYISLGSNIEPTHYLKAGLQSLRTYFGPLQLSSMYESESVGFNGTNFLNMVVCAQTE
LNIAEVVAQFKQIEQNHGRLMGAKKFSPRTLDIDLLLYDDVVCQTPVILPRAEIVSNAFV
LWPLSEIAPDLIHPLQQKTYVAMWDEYDKTSQKLWPVTFEWPYGLTF
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atggcacgtatatacattagtttaggcagtaatatagaacccactcactacctcaaggcg
ggtttacaatctttacgcacatacttcggtcccctgcaactttcctctatgtatgagagt
gaatcggtgggatttaacggtaccaattttttaaatatggtggtctgtgcccaaaccgag
ctgaatattgccgaggtagttgcgcagtttaagcaaatcgagcaaaatcacggccggctg
atgggggctaaaaagttcagtccaagaacgctagatattgatctactgctttacgatgat
gttgtttgtcaaaccccagtgatactgccccgagccgaaatcgtcagtaatgcttttgtg
ttgtggcctttatctgaaattgcgccggatttgattcacccattgcagcagaaaacctat
gtcgcaatgtgggatgaatatgataaaacgtcacaaaagctttggcctgtgacctttgaa
tggccttatgggctgactttttaa

DBGET integrated database retrieval system