KEGG   Shewanella oneidensis: SO_1483Help
Entry
SO_1483           CDS       T00099                                 

Gene name
aceB
Definition
(RefSeq) malate synthase A AceB (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
son  Shewanella oneidensis
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:son00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SO_1483 (aceB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SO_1483 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    SO_1483 (aceB)
Enzymes [BR:son01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     SO_1483 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1549279..1550928
Genome map
AA seq 549 aa AA seqDB search
MTEHTLSEQQVNLTLNKATANGTLALVGNTIPGQEVIFTEGAMALLESLCREFGAEVPTL
LAKRKDRQARIDKGALPDFLPETRAIRDGAWKIRGIPNDLLDRRVEITGPVERKMVINAL
NANAKVFMADFEDSLAPSWQKVVEGQINLRDAVRGEIEYTAPETGKHYKLGPNPAVLICR
VRGLHLKEKHVEFNQQSIPGGLFDFAMYFYHNYRQLLAKGSGPYFYIPKLESHIEARWWA
KVFAFVEERFCLQAGTIKCTCLIETLPAVFEMDEILYELRSNIVALNCGRWDYIFSYIKT
LKRHGDRVLPDRQAVTMDTPFLSAYSRLLIKTCHKRGALAMGGMAAFIPAKDPAQNEAVL
QRVRKDKELEARNGHDGTWVAHPGLADTAMGIFNEYIGQDHQNQLHITRDVDAPILAAEL
LKTCDGERTEQGMRLNIRIALQYLEAWISGNGCVPIYGLMEDAATAEISRASIWQWIQHG
KSLSNGKLVTKQLFKDMLVEELANVKKEVGSDRFTHGKFTQAAVLLEDITTSDELVDFLT
LPGYEMLTA
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgacggaacacactttaagtgagcaacaagtaaatttgacgctgaataaagccactgcg
aatggcactctggctctggtgggaaataccattcctgggcaagaggtgatttttaccgaa
ggtgcaatggcgttgcttgaatcactttgtcgtgaatttggggctgaagtgccaacctta
ctcgccaagcgtaaagatagacaagcgcgtatcgataaaggtgctttacctgacttttta
cctgaaactcgtgcgattcgtgatggcgcttggaagatccgcggtatcccgaatgacctg
cttgatcgccgcgttgaaattaccggccccgttgaacgtaagatggtaatcaatgcgctc
aatgccaatgccaaagtgtttatggctgattttgaagactctttggcaccaagctggcaa
aaagtggttgaaggccaaattaacctgcgtgatgcagtacgcggagagattgaatacacg
gccccagaaaccggtaagcactataagttaggccctaatcctgcggtattgatctgccgt
gtacgtggcctgcatttaaaagagaagcacgttgaatttaaccagcagtctatccctgga
ggtttgttcgattttgcgatgtacttttaccataactatcgtcaattgctggcgaagggc
agtggtccttacttctatattccaaaacttgagagtcatatcgaggcgcgctggtgggca
aaagtgtttgcttttgttgaggaaagattctgtcttcaagcgggtactatcaaatgtact
tgcttgattgagacgctgcctgcggtgtttgaaatggatgaaattctttatgagttgcgc
tccaacattgtcgcactcaactgtggccgttgggattatatcttcagctatatcaaaacg
ttaaaacgtcatggcgatcgtgtgttaccggaccgccaagcggtgactatggatacgcct
tttttaagtgcttactccagactgttgatcaaaacctgccataaacgtggcgcgttagcg
atgggcggcatggctgcctttattccagcaaaagatcctgcgcagaacgaagctgtgttg
cagcgggttcgaaaggataaagagctcgaagcccgtaatggccacgatggtacttgggtt
gcgcatcccggtctggcggatacggccatggggatttttaacgagtatatcggccaagac
catcaaaaccaattacacattacccgcgatgtagacgctccgattttagccgctgagtta
ttaaaaacctgcgatggcgagcgcaccgagcaaggcatgcgcctaaatattcgcatcgcg
ctgcaatatctggaggcatggatcagtggcaacggttgtgtgccgatttacggattaatg
gaagatgcggcaaccgctgaaatctcccgcgcctcgatttggcaatggatccaacatggt
aagtcactctccaatggcaaacttgttactaaacaattgtttaaagacatgctggtagaa
gagttggctaatgtgaaaaaagaagtgggcagcgacagatttacccacggcaaatttacc
caagcagcggtattgcttgaggatattaccacttctgatgagttggtcgacttcttaacc
ttacccggttacgagatgctaactgcttaa

DBGET integrated database retrieval system