KEGG   Shewanella oneidensis: SO_1484Help
Entry
SO_1484           CDS       T00099                                 

Gene name
aceA
Definition
(RefSeq) isocitrate lyase AceA
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
son  Shewanella oneidensis
Pathway
son00630  Glyoxylate and dicarboxylate metabolism
son01100  Metabolic pathways
son01110  Biosynthesis of secondary metabolites
son01120  Microbial metabolism in diverse environments
son01200  Carbon metabolism
Module
son_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:son00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SO_1484 (aceA)
Enzymes [BR:son01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     SO_1484 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-GeneID: 1169297
NCBI-ProteinID: NP_717101
UniProt: Q8EGV7
Position
1551063..1552385
Genome map
AA seq 440 aa AA seqDB search
MTKATQTSRQAQIDAIKKDWAENPRWKNVRRPYTAEEVVALRGSIVPENTIAKRGAAKLW
DLVNGGSKKGYVNSLGALTGGQAVQQAKAGIEAIYLSGWQVAADANLAGTMYPDQSLYPA
NSVPAVVSRINNSFRRADQIQWSNGVNPEDENFVDYFLPIIADAEAGFGGVLNAFELMKS
MIDAGAAGVHFEDQLASVKKCGHMGGKVLVPTQEAVQKLVAARLAADVSGVETLVIARTD
ANAADLLTSDCDPYDRDFVTGERTNEGFYRVNAGLDQAISRGLAYAPYADLIWCETAKPD
LEEARRFAEAIHAQYPDQLLAYNCSPSFNWKKNLDDATIARFQQALSDMGYKYQFITLAG
IHNMWYNMFDLAYDYARGEGMKHYVEKVQEVEFAAAKKGYTFVAHQQEVGTGYFDQVTTV
IQGGHSSVTALTGSTEEEQF
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgactaaggcaacacagacttcacgtcaggcgcagattgacgcgatcaaaaaagattgg
gcagagaatccacgttggaaaaacgtccgtcgtccatacactgcagaagaagttgtggca
cttcgtggttcaatcgtacccgaaaacaccattgccaagcgtggtgcagctaaattgtgg
gatctcgttaacggtggctcgaagaaaggttatgtgaactcgttaggcgcgctgactggc
ggccaagcggtacagcaagctaaagcgggtattgaagccatttatctgtctggttggcaa
gtggcggccgacgctaacttagctggcaccatgtacccagatcaatccttatacccagca
aactcagtacctgctgtcgtatcacgtattaataactccttccgccgcgctgaccaaatc
cagtggagcaacggtgtcaatcctgaagatgaaaactttgtcgattatttcctgccgatt
attgccgatgcggaagcaggttttggtggcgtactgaatgcgttcgagttaatgaagtcg
atgatcgacgcaggcgccgctggtgtgcactttgaggaccaattagcctcagtgaaaaag
tgcggtcatatgggcggtaaagtattagtaccaacccaagaagcggtacaaaaattggtt
gcagcgcgccttgctgctgacgtgagcggtgttgaaaccttagtgattgcccgtaccgat
gcgaacgcggcggatctgctgacctctgattgcgacccatatgaccgtgattttgtcact
ggcgagcgtaccaacgaaggtttctatcgcgttaacgcaggtctcgaccaagcaatttct
cgcggtctcgcttacgccccttatgcagatttaatttggtgtgaaactgctaagccagat
ttagaagaagcgcgccgttttgcggaagctatccatgctcagtacccagatcaattactg
gcctataactgctcaccttcgttcaactggaagaaaaacctggacgacgccacgattgca
cgcttccaacaagcgctgtcagacatgggctacaagtaccagttcatcactttagcgggc
atccataacatgtggtacaacatgtttgacctggcttacgattatgctcgtggtgaaggt
atgaagcattatgttgagaaagttcaagaagttgagtttgcggcagcgaagaaaggttac
accttcgtggcgcatcaacaggaagtgggcacaggttatttcgaccaagtgactacggtt
atccaaggcggccattcatcagtgactgcactgacgggctctaccgaagaagagcagttt
taa

DBGET integrated database retrieval system