KEGG   Shewanella oneidensis: SO_1493Help
Entry
SO_1493           CDS       T00099                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase MalQ (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
son  Shewanella oneidensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:son00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SO_1493 (malQ)
Enzymes [BR:son01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     SO_1493 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1557951..1560260
Genome map
AA seq 769 aa AA seqDB search
MGLEKLLYLRGVGADFTDCFGQYIRIPEADRQGILTCMLQDTNEPHNEAELSAVNRLTQS
AIAAQVYQLDAQHWTQVLPAFHWCYVDEPWVCLYLPQSYRGDLLLTFKCEQGEVIVFNVP
FSGLKPIGDYRIEESELARHGDSPFADECQFIQYRLDLLAHEFDCCDVSEQDKLSDVSCL
GLGYHKLSVSLGDTTSTLGDCTSGIHHAELTARKANEFYGHFMLAPRTAYQGVMNSVAQR
KRHKPWGVSVQLYSVRSDNQWGIGDFGDLEQLITLVAEYGADFIQLNPLHALDIAVPEQP
SPYSPCDRRRLNPLYIHLSSVPEFELLAEEFAANEWQEAIALLNTENWLDYPKVSELKYR
AFARLYTVFCESHLQQRTLRAQRFHVFVKQEGESLREFAQAEYLRSPSAIAQDESFYLYL
QFVAEEQLQLCQLKAKEAGMGIGLIRDLAVGAALQGVEVQANSQLFCLNASIGAPPDPFA
PQGQNWGLTPLDPIKLKQDRYRHFIALIRANMTYCGALRIDHVMGLLRLWWWPLDKRLGQ
GAYVYYPVETLLAILCLESQRARCVVIGEDLGLVPPDIIHRLYHAGVYSNELFYFCKDHQ
GFKPPSQYKFQSLMMLANHDVPTLVAWWTGSDLHLRRQLDLLTTDEQLGEALAGREQEKH
QLVHSLISQGLLPETDIQQIDLEDLLTAWMALGASGNSALYSVQWCDLLADRHAVNIPGT
WLEYPNWQRRLPITLRDAATQSTVALRLQRIAAARHLPEIAAQTDNTFD
NT seq 2310 nt NT seq  +upstreamnt  +downstreamnt
atggggctggagaagttgctgtatttgcggggcgtaggagcagactttaccgactgcttc
ggccagtacattcgcattcccgaagctgacaggcaagggattttgacctgtatgttacag
gatactaatgagccgcataacgaggctgagttgtcagcggtgaatcggctcacacagagt
gctatcgcagcccaagtttatcaattagacgcacagcattggacccaagtattaccggca
tttcattggtgttatgtcgatgaaccatgggtgtgcttatatttacctcaatcttaccgt
ggcgatctgctgctgacgtttaaatgtgagcaaggtgaggtaattgtctttaatgtgccg
ttttcaggcttaaagccgattggggattatcgtattgaggaatccgagttagcgcgacat
ggcgatagcccatttgccgacgaatgccagtttattcaatatcgtctcgatcttttagcg
catgagtttgattgctgcgatgtctctgagcaagacaagctcagcgatgtgtcctgcctt
gggctgggttaccacaagctcagcgtcagcttgggtgatacgacttctactttaggggat
tgtacttcagggattcatcatgccgagctaacagcaaggaaggcgaatgagttctatggc
cactttatgctggcaccgcggacggcttatcaaggcgtgatgaacagcgtggcgcaaaga
aaacgccataaaccttggggcgtgagtgttcagctttacagtgtacgcagtgataaccaa
tgggggatcggcgactttggcgatctagagcaactcatcaccttagttgccgaatatggc
gctgattttattcaactcaatccattacatgccttagatattgccgtgccggaacagcct
agtccttatagtccctgtgatcggcgccggcttaatcctctgtatattcacttgtcgagc
gtgcctgagtttgagctcttggctgaggaatttgccgccaatgaatggcaagaagccatt
gcactactcaatactgaaaattggctcgattatcccaaggtgagtgagcttaagtaccgc
gcctttgcccgtttatacacagtgttttgcgaaagccatttacagcaacgtacgctaagg
gcgcagcgttttcatgtttttgtcaaacaagagggtgagtcgctacgggagtttgctcag
gccgaatacttacgtagccctagcgccattgcgcaggatgaaagtttttatctttatctg
cagtttgtggccgaagagcaactgcaactgtgccagcttaaggcaaaagaagcgggcatg
ggcatcgggctaattcgcgatcttgcagtgggtgcagccttacaaggtgttgaggtgcaa
gccaattcacaactgttttgtctaaacgctagcataggcgcgccgccggatccctttgcg
ccccaaggccaaaattggggcttaacccccctcgatcctattaagttaaagcaagatcgc
tatcgccattttattgcgttaatccgcgccaatatgacgtactgtggcgcactgcgaatt
gaccatgtgatggggctgttacggctctggtggtggcctctggataaacgtcttgggcag
ggcgcctatgtctattaccccgttgaaactttgctggcgatactctgtcttgaaagtcag
cgcgcccgctgtgtggtgattggcgaagacttaggcctagtcccgcctgacattattcac
cgcctgtatcacgccggcgtttactccaacgaactgttctacttctgcaaggatcatcaa
ggctttaagccgccgagccaatataagttccaaagtttgatgatgctggcaaaccacgat
gtgcccaccttggtcgcttggtggacgggcagtgacttgcacctgaggcgtcaactcgac
ttactcacaaccgacgagcaattaggtgaggcattggctggacgtgagcaggaaaaacac
cagcttgtgcacagtttaatctcccaaggtttattgcctgagacagatattcaacagatt
gatcttgaagatttattaaccgcgtggatggcattgggtgcctcaggcaatagtgcgctt
tacagcgtgcaatggtgcgatctgctggctgatcgccatgcggtcaatatccctggcact
tggctcgagtaccccaattggcagcgacgattgccgatcacgttaagggatgccgcgacc
caaagcactgtcgcactgcgcttgcaacgcattgctgctgcgagacatttgccggaaatc
gctgcacaaacagataacacctttgactaa

DBGET integrated database retrieval system