KEGG   Shewanella oneidensis: SO_1635Help
Entry
SO_1635           CDS       T00099                                 

Gene name
dxr
Definition
(RefSeq) 1-deoxy-D-xylulose 5-phosphate reductoisomerase Dxr
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
son  Shewanella oneidensis
Pathway
son00900  Terpenoid backbone biosynthesis
son01100  Metabolic pathways
son01110  Biosynthesis of secondary metabolites
son01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:son00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SO_1635 (dxr)
Enzymes [BR:son01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     SO_1635 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXPR_C DXP_reductoisom DXP_redisom_C NAD_binding_3 Semialdhyde_dh
Motif
Other DBs
NCBI-GeneID: 1169429
NCBI-ProteinID: NP_717246
UniProt: Q8EGG9
Position
1716296..1717486
Genome map
AA seq 396 aa AA seqDB search
MQNMVILGATGSIGASTLSVISANPTAYRVYALVANASVDKMLTLCLAHRPQVAHMVDHK
AALALKAQLPAALNIQVTSGEDELIALVTAPAVDTVMAAIVGAAGLVPTLAAVKAGKRVL
LANKEALVMSGELFIEATRASGATLLPVDSEHNAIFQCLPEEVQSNLGRCDLAASGISHI
LLTGSGGPFLTAELSNLAAMTPAQACKHPNWSMGPKISVDSATMMNKGLEFIEARWLFNT
QKDQLKVVIHPQSVIHSMVQYRDGSVIAQMGNPDMRTPIAHCMSYPQRIRSGVEPLDFFK
VGQLSFCEPDFNRFPCLALAIEACSQGQEATTVLNAANEIAVEAFLQGKIGFTHIGKINE
DCLLSVPKQAMASIEDIIALDAQTRIYARELLAKFA
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaatatggtgattttgggtgcgacaggctcgattggtgccagcaccttaagtgtg
atttcggctaatcctacagcctatcgagtgtatgctttagtggcgaatgcgagcgttgat
aagatgctcaccctgtgtttggctcatcgccctcaggttgctcatatggttgaccacaaa
gccgctttagcactcaaggcgcaattacctgcagcactgaatatccaagtcaccagtggt
gaggatgagcttattgccttagtcaccgcaccagcggttgatactgtgatggcggcaatt
gttggtgcagcggggttagtgcccacactggcggcggtgaaggcgggtaagcgggtattg
ctcgccaataaagaggcgttggtgatgtccggcgagctgtttattgaggccaccagagcc
tcgggcgccactttgctgccggtcgacagtgaacacaatgcgattttccaatgcttgcct
gaagaagtgcagagcaatttagggcgctgcgacttagcggcctctggtatttcccatatt
ttactaactggctctggtggtccatttttaactgcagagctatcaaatcttgcggcaatg
acgcctgcgcaggcctgtaaacatccaaattggtccatgggaccgaagatttcagtcgac
tccgccacgatgatgaataaaggtttagagtttattgaagcccgttggttgttcaacacc
cagaaagaccagttgaaagtggttattcatccgcagagtgttattcactcgatggtacaa
taccgcgatggtagtgtgattgcgcagatgggcaacccagacatgcgcacgcctatcgcc
cattgtatgtcctatccgcaaagaattcgctccggtgttgaacctttagattttttcaaa
gtcggacagttaagcttttgtgagccagactttaatcgcttcccttgtttagcgttagcg
atagaggcttgctcccaaggccaagaggcgacaacggtacttaatgcggccaatgaaatc
gccgtggaggcgtttttacaaggtaagatagggtttacccatatcggcaagataaacgaa
gactgtttattgtccgtcccaaaacaggcgatggccagcatcgaagatatcatcgccctt
gatgcccagacacggatatatgcccgtgaattactagcgaaattcgcttag

DBGET integrated database retrieval system