KEGG   Shewanella oneidensis: SO_1665Help
Entry
SO_1665           CDS       T00099                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase GalU (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
son  Shewanella oneidensis
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:son00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SO_1665 (galU)
   00052 Galactose metabolism
    SO_1665 (galU)
   00500 Starch and sucrose metabolism
    SO_1665 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    SO_1665 (galU)
Enzymes [BR:son01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SO_1665 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1752229..1753137)
Genome map
AA seq 302 aa AA seqDB search
MKQHQIRKAVIPVAGLGTRMLPATKAIPKEMLPVVDKPLIQYVVSEAIAAGIKEIVLVTH
ASKNSIENHFDTSFELEAQLERRVKRQLLEAVQSICPKDVTVISVRQSQAKGLGHAILCA
KSVVGDAPFAVLLPDVIIDEASCDLKTDNLASMVSLFDETQVGQIMVEGVPHHLVNQYGI
ADVNGHDLQPGESEPLVELVEKPPVDEAPSNLAVVGRYVLPAAIWPLLAKTPAGAGDEIQ
LTDAIAMLMKEETVNAYYMQGKSHDCGNKQGYMRANVEYALRHSEIGEDFAHYLKTVVKG
IK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaacatcaaattcgtaaagccgttattcctgtcgccggacttggcactcgtatg
cttcctgcgactaaagctatccctaaggaaatgctacccgttgttgataagccattgatc
caatatgtcgttagtgaagccatcgctgcgggtatcaaagaaattgttctcgtgacccac
gccagtaaaaactccatcgaaaaccatttcgacaccagttttgaattagaggcgcaacta
gagcgccgcgtgaaacgtcaattgctcgaagccgtgcaatccatttgccctaaagatgtc
acagtgatcagcgtgcgccaatcccaagctaaaggcttaggtcatgcgattttatgcgct
aaatccgtggtaggtgatgcaccttttgccgtattactgccagatgtgattatcgatgag
gccagttgcgacttaaaaaccgataaccttgcctctatggtaagcctgtttgatgaaact
caagtcggtcaaatcatggttgaaggtgtgccgcatcatttagtaaatcaatatggtatt
gccgatgtgaacggccacgatttgcagcctggtgaatcagagccattagtcgagctggtt
gaaaaaccaccggttgatgaagcgccatctaacttagccgttgttggccgttacgtgtta
ccggcggcaatttggccactgcttgccaaaacaccagcaggcgcaggagatgaaatccaa
ttaactgacgcgattgcaatgttaatgaaggaagaaacggtaaacgcttactacatgcaa
ggtaagagtcacgactgcggtaataagcaaggctatatgcgcgctaacgtggaatacgcg
ctgcgccacagcgaaatcggtgaagattttgcccactacttaaaaacagttgtaaaggga
attaaataa

DBGET integrated database retrieval system