KEGG   Shewanella oneidensis: SO_1665Help
Entry
SO_1665           CDS       T00099                                 

Gene name
galU
Definition
(RefSeq) UTP-glucose-1-phosphate uridylyltransferase GalU (EC:2.7.7.9)
  KO
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
son  Shewanella oneidensis
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:son00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SO_1665 (galU)
   00052 Galactose metabolism
    SO_1665 (galU)
   00500 Starch and sucrose metabolism
    SO_1665 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    SO_1665 (galU)
Enzymes [BR:son01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SO_1665 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1752229..1753137)
Genome map
AA seq 302 aa AA seqDB search
MKQHQIRKAVIPVAGLGTRMLPATKAIPKEMLPVVDKPLIQYVVSEAIAAGIKEIVLVTH
ASKNSIENHFDTSFELEAQLERRVKRQLLEAVQSICPKDVTVISVRQSQAKGLGHAILCA
KSVVGDAPFAVLLPDVIIDEASCDLKTDNLASMVSLFDETQVGQIMVEGVPHHLVNQYGI
ADVNGHDLQPGESEPLVELVEKPPVDEAPSNLAVVGRYVLPAAIWPLLAKTPAGAGDEIQ
LTDAIAMLMKEETVNAYYMQGKSHDCGNKQGYMRANVEYALRHSEIGEDFAHYLKTVVKG
IK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaacatcaaattcgtaaagccgttattcctgtcgccggacttggcactcgtatg
cttcctgcgactaaagctatccctaaggaaatgctacccgttgttgataagccattgatc
caatatgtcgttagtgaagccatcgctgcgggtatcaaagaaattgttctcgtgacccac
gccagtaaaaactccatcgaaaaccatttcgacaccagttttgaattagaggcgcaacta
gagcgccgcgtgaaacgtcaattgctcgaagccgtgcaatccatttgccctaaagatgtc
acagtgatcagcgtgcgccaatcccaagctaaaggcttaggtcatgcgattttatgcgct
aaatccgtggtaggtgatgcaccttttgccgtattactgccagatgtgattatcgatgag
gccagttgcgacttaaaaaccgataaccttgcctctatggtaagcctgtttgatgaaact
caagtcggtcaaatcatggttgaaggtgtgccgcatcatttagtaaatcaatatggtatt
gccgatgtgaacggccacgatttgcagcctggtgaatcagagccattagtcgagctggtt
gaaaaaccaccggttgatgaagcgccatctaacttagccgttgttggccgttacgtgtta
ccggcggcaatttggccactgcttgccaaaacaccagcaggcgcaggagatgaaatccaa
ttaactgacgcgattgcaatgttaatgaaggaagaaacggtaaacgcttactacatgcaa
ggtaagagtcacgactgcggtaataagcaaggctatatgcgcgctaacgtggaatacgcg
ctgcgccacagcgaaatcggtgaagattttgcccactacttaaaaacagttgtaaaggga
attaaataa

DBGET integrated database retrieval system