KEGG   Shewanella oneidensis: SO_1677Help
Entry
SO_1677           CDS       T00099                                 

Gene name
ivdA
Definition
(RefSeq) 3-ketoacyl-CoA thiolase IvdA
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
son  Shewanella oneidensis
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:son00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SO_1677 (ivdA)
   00630 Glyoxylate and dicarboxylate metabolism
    SO_1677 (ivdA)
   00640 Propanoate metabolism
    SO_1677 (ivdA)
   00650 Butanoate metabolism
    SO_1677 (ivdA)
  Lipid metabolism
   00071 Fatty acid degradation
    SO_1677 (ivdA)
   00072 Synthesis and degradation of ketone bodies
    SO_1677 (ivdA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SO_1677 (ivdA)
   00310 Lysine degradation
    SO_1677 (ivdA)
   00380 Tryptophan metabolism
    SO_1677 (ivdA)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SO_1677 (ivdA)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SO_1677 (ivdA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SO_1677 (ivdA)
Enzymes [BR:son01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SO_1677 (ivdA)
Exosome [BR:son04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SO_1677 (ivdA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
1763186..1764376
Genome map
AA seq 396 aa AA seqDB search
MSTELLNQEIVIVAAKRTPMGSFQGSLSGITSLSLAATAIKALLADTQVAPDKVDEVLMG
CVLPAGLGQAPARQATLGAGLPLSVGATTVNKVCGSGMKTVMLAHDLIKAGSAKVVIAGG
MESMSQAPYLLDKARAGIRMGHGKVLDHMFLDGLEDAYTGGAMGTFAQKTADEFGITREQ
MDAFALSSLEKANAAINSGAFKTEIVPVTVSDRRGDVTIDTDEQPGNARPEKIPTLRPAF
AKDGTITAANSSSISDGAAALMLTTRANAEQLGLTVLATIKGHTTHAQEPALFTTAPVGA
MAKLLSNVGWSKDEVDLFEINEAFAMVTMLAVSELGLDMTKVNVNGGACALGHPIGCSGA
RLLVTLIHALKARGLKRGVASLCIGGGEATAMAIEV
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgagtactgaactattaaaccaagagatcgttattgttgccgctaaacgcaccccaatg
ggtagttttcaaggcagtttgtctggcatcacttctctgagcttagcggccacagcaatc
aaagccctgttagccgatacccaagttgcgcctgacaaggtcgatgaggtgttgatgggc
tgcgtattgccagcgggtcttggtcaagcgcctgcgcgccaagcaaccttaggggcaggt
ttaccgctgtctgtgggtgcaaccacagtgaacaaggtctgtggttcagggatgaaaacg
gtgatgcttgcccatgatttgattaaagcgggcagtgctaaggtggtgattgctggtggt
atggaaagcatgagccaagcaccttacttgctcgacaaagcgcgcgctggtatacgtatg
ggccatggcaaagtgttagatcatatgttcctcgacggtttagaagatgcttacactggc
ggcgctatgggcacattcgcccagaaaaccgccgatgaatttggtatcactcgcgagcaa
atggatgcgtttgctttaagctcactcgaaaaagccaacgctgccattaattctggtgct
ttcaaaacggagatagtgcccgtaacggtaagcgatcgccgtggtgacgtgactattgat
accgatgagcagccaggtaacgctcgccctgaaaaaatccccacgttgcgtccagccttt
gctaaagatggcactattactgcggcaaactccagctcgatttccgatggtgcagcggcg
ctgatgttaacaacgcgcgccaatgctgagcagttaggcttaactgtgctcgccaccatc
aagggccacactacccatgcgcaggagcctgcactttttaccaccgcacccgttggcgcg
atggcaaaactattgagtaatgtgggctggtcaaaggatgaagttgatctgtttgagatc
aacgaagccttcgccatggtgactatgctggccgtttctgaattaggtttagatatgaca
aaagtcaacgtgaatggcggcgcttgtgccttaggtcatcctatcggttgctcgggcgcg
cgtttactggtgaccttaatccatgcacttaaagcccgcggacttaagcgcggtgtagcg
tcgctctgtatcggtggtggtgaagcgacggctatggctattgaagtctaa

DBGET integrated database retrieval system