KEGG   Shewanella oneidensis: SO_2049Help
Entry
SO_2049           CDS       T00099                                 

Definition
(RefSeq) diguanylate cyclase (EC:2.7.7.65)
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
son  Shewanella oneidensis
Brite
Enzymes [BR:son01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     SO_2049
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
2149232..2150260
Genome map
AA seq 342 aa AA seqDB search
MSSPAANKELDASAQILRLAVPQMSALDIPVTPENYTVWYEYFAQSNLDLNRAIDGFLAN
NVVFTKEVNTSLYKNFIQEKSPEVIENVQIETQILINSLISKITQLNQGTEAFSNTLADF
GLQLQSSPDVNTLNQLVDGVIDEMQNLLVNNQTMEQSLNAMGQEVQNLKTEMENLSLAAM
TDQLTSLHNRRAYEIAIQDHIHRAEEQHTRCSLLLIDIDRFKVFNDTYGHQVGDKVLAYV
ALALKQCVRGDDFVARYGGEEFVVLLPNTHFHDALQVAETLRGRISERRLAIGKDKKLSL
GAITVSIGLASLQKGDDAETLFSRADKALYEAKSDGRNCVRG
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgtcttctcccgctgcaaacaaagagctcgatgcctcagcacaaattttacgcttagct
gtaccgcaaatgtccgcacttgatattccggtaacgccagaaaactacacggtctggtat
gagtattttgcccagtcgaatttggatttaaatcgtgctattgatggttttcttgcaaac
aacgtggtatttaccaaagaagtgaataccagtctgtataagaattttatccaagagaag
tcccctgaagttatcgaaaatgtccagattgaaacccagatattgattaactctcttatc
agtaaaattacccagctaaaccaaggaacagaggcattttccaacacattagcggacttt
ggcctacagctccaatcttcacccgatgtgaacaccttaaatcaattggtcgatggggtg
attgatgaaatgcagaatctattggtcaataaccaaaccatggagcagagtctcaatgcc
atggggcaagaagtacaaaatttaaaaacggaaatggagaatttaagtctggcggcaatg
acagaccaattgacctcactacataaccgccgtgcctacgaaattgccattcaagaccat
attcaccgcgcggaggagcaacatacccgttgtagtttattacttatcgacatcgacaga
tttaaggtgtttaacgatacctatggtcatcaggttggtgataaagtcttggcttatgtt
gcgcttgctttaaaacaatgtgtgcgtggcgatgactttgtggcccgttatgggggagaa
gaatttgtggtgttattgcccaatacccatttccatgatgcattgcaagtggctgagacc
ttacgagggaggatctccgagcgccgcttggctataggcaaagataaaaaactttcattg
ggcgccattacggtgtcaattggcttagcctctttgcaaaaaggcgatgatgcagaaact
ctatttagccgtgctgataaagccttgtatgaagccaaatccgatggccgtaactgtgtg
cggggctaa

DBGET integrated database retrieval system