KEGG   Shewanella oneidensis: SO_2049Help
Entry
SO_2049           CDS       T00099                                 

Definition
diguanylate cyclase (EC:2.7.7.65)
Orthology
K13590  
diguanylate cyclase
Organism
son  Shewanella oneidensis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2149232..2150260
Genome map
AA seq 342 aa AA seqDB search
MSSPAANKELDASAQILRLAVPQMSALDIPVTPENYTVWYEYFAQSNLDLNRAIDGFLAN
NVVFTKEVNTSLYKNFIQEKSPEVIENVQIETQILINSLISKITQLNQGTEAFSNTLADF
GLQLQSSPDVNTLNQLVDGVIDEMQNLLVNNQTMEQSLNAMGQEVQNLKTEMENLSLAAM
TDQLTSLHNRRAYEIAIQDHIHRAEEQHTRCSLLLIDIDRFKVFNDTYGHQVGDKVLAYV
ALALKQCVRGDDFVARYGGEEFVVLLPNTHFHDALQVAETLRGRISERRLAIGKDKKLSL
GAITVSIGLASLQKGDDAETLFSRADKALYEAKSDGRNCVRG
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgtcttctcccgctgcaaacaaagagctcgatgcctcagcacaaattttacgcttagct
gtaccgcaaatgtccgcacttgatattccggtaacgccagaaaactacacggtctggtat
gagtattttgcccagtcgaatttggatttaaatcgtgctattgatggttttcttgcaaac
aacgtggtatttaccaaagaagtgaataccagtctgtataagaattttatccaagagaag
tcccctgaagttatcgaaaatgtccagattgaaacccagatattgattaactctcttatc
agtaaaattacccagctaaaccaaggaacagaggcattttccaacacattagcggacttt
ggcctacagctccaatcttcacccgatgtgaacaccttaaatcaattggtcgatggggtg
attgatgaaatgcagaatctattggtcaataaccaaaccatggagcagagtctcaatgcc
atggggcaagaagtacaaaatttaaaaacggaaatggagaatttaagtctggcggcaatg
acagaccaattgacctcactacataaccgccgtgcctacgaaattgccattcaagaccat
attcaccgcgcggaggagcaacatacccgttgtagtttattacttatcgacatcgacaga
tttaaggtgtttaacgatacctatggtcatcaggttggtgataaagtcttggcttatgtt
gcgcttgctttaaaacaatgtgtgcgtggcgatgactttgtggcccgttatgggggagaa
gaatttgtggtgttattgcccaatacccatttccatgatgcattgcaagtggctgagacc
ttacgagggaggatctccgagcgccgcttggctataggcaaagataaaaaactttcattg
ggcgccattacggtgtcaattggcttagcctctttgcaaaaaggcgatgatgcagaaact
ctatttagccgtgctgataaagccttgtatgaagccaaatccgatggccgtaactgtgtg
cggggctaa

DBGET integrated database retrieval system