KEGG   Shewanella oneidensis: SO_2136Help
Entry
SO_2136           CDS       T00099                                 

Gene name
adhE
Definition
aldehyde-alcohol dehydrogenase AdhE (EC:1.1.1.1 1.2.1.10)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
son  Shewanella oneidensis
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:son00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SO_2136 (adhE)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SO_2136 (adhE)
   00620 Pyruvate metabolism
    SO_2136 (adhE)
   00650 Butanoate metabolism
    SO_2136 (adhE)
  Lipid metabolism
   00071 Fatty acid degradation
    SO_2136 (adhE)
  Amino acid metabolism
   00350 Tyrosine metabolism
    SO_2136 (adhE)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SO_2136 (adhE)
   00626 Naphthalene degradation
    SO_2136 (adhE)
Enzymes [BR:son01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SO_2136 (adhE)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     SO_2136 (adhE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2242231..2244831)
Genome map
AA seq 866 aa AA seqDB search
MTVTNAQKLDLMVERVARAQAEYASFSQAQVDAIFRAAALAAADARISLAKMAAAETRMG
VIEDKVIKNHFASEYIYNKYKDEKTCGILSEDPTFGTITIAEPVGIICGIVPTTNPTSTA
IFKALISLKTRNAIIFSPHPRAKVSTTTAAKLVLDAAIAAGAPKDIIGWIDEPSVALSNQ
LMTHPKVNLILATGGPGMVKAAYSSGKPAIGVGAGNTPIVIDETADIKRAVSSILMSKTF
DNGVVCASEQAVIVVDSIYEQVKERFATHGGYLLNAAQTEAMQQVILKNGGLNADIVGQS
AATIAQMAGIEVPHTTKVLIGEVTDISETEAFAHEKLSPLLGMYRAADFNDAVDKAETLV
ALGGIGHTSGLYTDQDTQTERVKSFGFRMKTARILINTPASQGGIGDLYNFKLAPSLTLG
CGSWGGNSISENVGPSHLINKKTVAKRAENMLWHKLPSSIYFRRGSLPIALEELSDKKRA
LIVTDPFLFNQGYCDETLKILKAQGLETEVFYEVEADPTLATVRQGAKVANSFKPDVIIA
LGGGSPMDAAKIIWVMYEHPDVDFADLALRFMDIRKRIYKFPKMGVKATMVAIPTTSGTG
SEVTPFAVVTDEQTGKKYPIADYQLTPNMAIVDPNLVMDMPKSLTAFGGIDAITHALEAY
VSVMANEYSDGQALQALDLLCKYLPDAYQLGAASPIAREKVHNGATIAGIAFANAFLGIC
HSMAHKLGAEFHLAHGLANALLISNVIRFNATDLPTKQAAFSQYDRPKALCRYAAIADHL
ALGGNSDAQKVEKLLEKIEQLKKTLGIPASIQEAGVNEADFLAKLDMLAEDAFDDQCTGA
NPRYPLISELKQLLLDSYYGRPFTEQ
NT seq 2601 nt NT seq  +upstreamnt  +downstreamnt
atgacagtaacgaatgcccaaaaactggatctcatggtcgagcgcgtagccagagcgcaa
gccgaatatgccagttttagccaagcacaagttgatgcgattttccgtgccgccgctctc
gccgcagcagatgcacggatttcactggcaaaaatggccgctgccgaaactagaatgggg
gtgattgaagacaaagtgattaaaaaccactttgcctccgagtatatttacaacaagtac
aaggatgaaaagacctgtgggattttatccgaagatcctactttcggcacaatcactatt
gccgagcccgttggcattatctgcggtatcgtccccactactaatccaacgtccactgcc
atctttaaggcactcatcagccttaaaacccgcaatgcaattattttctcccctcaccca
agggcaaaagtctcgaccaccactgcggccaaactggtgttagatgcggccattgccgca
ggcgcacccaaagatattatcggttggattgatgagcctagtgttgcgctctcaaaccag
ctaatgacgcaccctaaagtgaatcttatcctcgccacaggcggcccaggtatggtgaaa
gcggcctattcttcaggtaaacccgccattggtgtcggcgcaggtaacaccccaattgtg
attgatgaaaccgccgacattaaacgcgcagtgagctcgattctgatgtctaaaaccttc
gataacggcgttgtgtgtgcctcggagcaagcggtaattgtggtcgacagcatctacgag
caagttaaagagcgctttgcgacccatggcggttatctcttaaatgcggcgcaaactgaa
gctatgcaacaggttatccttaaaaatggcggtttaaatgccgatatcgtcggccaaagt
gctgcgaccatagcgcaaatggcgggaattgaagtcccccacaccactaaggtattgatt
ggtgaagtcaccgatattagtgagacagaagcctttgcccacgaaaaactttcaccttta
ctcggcatgtaccgcgccgctgattttaatgacgccgtcgataaggctgaaacactggtc
gccttaggtggcataggccatacatctggcctgtataccgaccaagacacccaaaccgaa
cgggtcaaatcctttggttttagaatgaaaaccgcacgcattttgatcaataccccagcc
tctcagggtgggatcggcgatctgtacaactttaaactagccccctcgctcaccttaggt
tgcggctcttggggcggaaactcgatttctgaaaacgtcggtccaagtcatttgattaac
aagaaaaccgtcgctaagagggctgaaaacatgctgtggcacaagcttccttcatctatc
tacttccgccgtggcagtttaccgattgcgctggaagaactgagtgataagaaacgcgca
ctgatagtgaccgacccatttctgttcaaccaaggttattgcgatgaaaccttaaaaatc
cttaaggcacagggtttagaaaccgaagtgttttacgaagttgaagctgaccccactctg
gccaccgtgcgccaaggcgctaaagtggccaatagctttaaacccgatgtgattattgcc
ttaggtggtggctcacctatggatgcggccaagattatttgggtgatgtacgagcatccc
gatgtcgactttgccgatttagccctgcgttttatggatatccgtaaacgtatctataaa
tttcctaaaatgggcgtaaaagctaccatggtcgcgattcctacgacatcgggtacaggt
tctgaggtcacccccttcgccgtagtgaccgatgaacaaaccggcaaaaaatatcccatt
gccgactatcaactcacccctaacatggccattgttgacccgaatctggtgatggatatg
cctaaatccttaaccgctttcgggggcatcgatgcaatcacccacgcgctcgaagcctat
gttagcgtgatggcgaacgagtacagcgatggtcaagccctgcaagcactcgatctgctg
tgcaaatatctgccagatgcctatcagctcggcgctgcatcccccatcgcccgagagaaa
gtccacaatggcgcaaccatcgctggtatcgcctttgctaacgccttccttgggatctgc
cactctatggcccacaagctgggcgccgagttccacttagcccatggactggctaacgcg
ctgctgatcagtaacgtgatccgctttaatgcgaccgacttacccactaagcaagccgca
ttcagtcaatacgacagacctaaagccctgtgtcgttacgcggccattgccgatcattta
gccttaggcggcaactcagatgcacaaaaagttgaaaaattgctggagaaaatcgagcag
ctcaagaagacgctgggcattcctgcgtcaatccaagaagccggtgttaatgaagccgac
ttcctcgccaagttagatatgcttgccgaggatgccttcgatgaccaatgtaccggtgca
aatcctcgctatccgttaattagcgagctaaaacagctactactagacagctactacggc
cgcccttttaccgaacaataa

DBGET integrated database retrieval system