KEGG   Shewanella oneidensis: SO_2147Help
Entry
SO_2147           CDS       T00099                                 

Gene name
recD
Definition
exodeoxyribonuclease V alpha subunit RecD (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
son  Shewanella oneidensis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:son00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SO_2147 (recD)
Enzymes [BR:son01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     SO_2147 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2253515..2255686)
Genome map
AA seq 723 aa AA seqDB search
MNHSTDTNSADMNNATALAANWYNAGALRLKAPLTELLKYWEKERLITALDRHFALEMAR
LHPNDAQEPLFMLLCALLSQQLSAQHTCLVLEYIVPTNPMAEPINRCQIRLSLTELIDAL
QHFDAIGAPNSNKPLIFEDGRLYLERYHHFETQVASALTRLSAAALSLTPSQPLASDNQS
LLQLRRQLDCLFPSAAHTVEANIDWQKVATATALGNKLAVITGGPGTGKTTTVTKLLLLQ
QLGTPKQIRLVAPTGKAAARLSESIKASKARLEQELQQASKENPQENQVLLTALSRIPEE
ASTLHRLLGVIPNSAHFRHHQGNPLRLDLLIVDEASMVDLPMMYKLLSALPEHAGLILLG
DQDQLASVEAGAVLADICAGLKQASTQHTEWKMRYSQAQAEQLTALTGFNLSHFIHSEPK
IGDSLCMLTHSHRFKGDAGIGLLASAVNRADLAGILSVWQSGLAELTWLEHSVDHSQTQA
KISEPSNNTGLKALLAQACEQYGDYLRLLQPTHATPIHTSEPFCPPSAMEAIAKFNQYRI
LCAMRTGDYGVEGINLAVTKALAQAKLIQPQQEFYLGRPIIIQSNDYNLGLFNGDIGLIL
QDEERADRLMAHFIKADGKLLKVLPARLPSHETCYAMTVHKSQGSEFNRVALVLPPAPSL
VQWQLLTKELIYTAITRAKQHFSCLGTQQVFERASLQATQRASGLADRLWGDQSLSHTAA
VNS
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atgaaccacagcaccgatacgaacagcgccgacatgaataacgccactgcccttgccgcc
aattggtacaatgcaggcgcgctgagacttaaagcaccactgactgagttgctcaaatat
tgggagaaagagcggcttatcaccgctctcgatcgccattttgccctcgagatggcccgt
cttcaccccaatgacgcccaagagccactgtttatgctgctgtgcgccctgttgagtcag
caactgtcggcccaacatacttgtctagtgctcgaatatatagtgccaaccaatccgatg
gcagagccgataaaccgctgtcaaatccgtttaagccttactgaactgattgacgcactg
caacactttgacgccattggagcaccaaatagcaataaaccactgatttttgaggatggt
agactctatcttgagcgttatcatcattttgaaacccaagttgccagcgccttaacaagg
ttatcagcggcggcgctttcgttaacgccatcgcagcctttagcatcggataatcaatca
cttttacagctacgcaggcaactggattgcttatttccaagcgcagcccacaccgttgaa
gcgaacatcgattggcaaaaggtcgccactgcaacggcgctcggtaacaagctggcggtg
ataacgggtggccccggtacaggtaaaaccactacggtgactaaattgctgttgttacaa
caattaggtacaccaaagcaaataagacttgtcgccccgacgggcaaagcggccgcccgt
ttaagtgaatccattaaggcttctaaagcgaggctcgagcaagagcttcaacaagcgagc
aaggaaaaccctcaagaaaaccaagtgttattaaccgcactgagtcgtatccccgaggag
gcatcaaccttacatcgcctgctgggtgtcattcccaattcagcgcattttcgccatcat
caaggtaacccattacggctcgatcttttgattgtggatgaagcctccatggtcgatttg
cctatgatgtacaagctgctcagcgcattgccggaacacgcaggcttgatattgcttggg
gatcaggatcaactcgcttcagttgaggcaggcgccgtacttgccgatatttgcgccgga
cttaagcaagcctcgactcaacataccgagtggaaaatgcgttatagccaagcacaggcc
gagcaattaaccgcgctcacgggctttaatttaagccactttatccacagtgagcctaaa
attggcgatagcctgtgtatgctaacccacagccatcgatttaaaggcgatgccgggatt
ggcttgctggccagcgcagtcaaccgcgccgatctcgcaggtattttatccgtttggcaa
agcgggcttgctgaattaacctggttagaacacagcgtagatcacagccaaacccaagca
aaaatcagtgaacctagcaacaataccggacttaaagcgctacttgcacaggcctgtgag
caatacggtgactatttacgcctgttacagccaacgcacgccactccaatacatacgagt
gagccattttgcccgccaagcgccatggaggcgattgccaaatttaatcaatatcgcatt
ttgtgcgccatgcgaaccggcgattatggtgtcgaagggattaatcttgcggtgactaag
gcattagcgcaggccaaacttattcagcctcagcaggagttttacctcgggcgccccatt
atcatccaaagtaacgactataacttaggcctgtttaacggcgatattggcttgattttg
caggatgaagagagagctgaccgcctgatggcccactttattaaagctgatggcaaactg
cttaaagtgttacccgcaaggctacctagccacgaaacctgttacgccatgacggtgcat
aaaagccaaggcagtgaatttaatcgagtcgccttagtgctcccgcctgcaccgagccta
gttcagtggcaattattaacaaaagagctgatctacaccgcaattacccgtgcaaaacaa
cactttagttgcctaggcactcagcaggtttttgaacgcgcaagcctgcaagctacccaa
cgcgcctcgggattagccgacaggctgtggggcgatcaatcgctgagccatacagcagca
gtcaatagctaa

DBGET integrated database retrieval system