KEGG   Shewanella oneidensis: SO_2178Help
Entry
SO_2178           CDS       T00099                                 

Gene name
ccpA
Definition
diheme cytochrome c5 peroxidase CcpA (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
son  Shewanella oneidensis
Brite
Enzymes [BR:son01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     SO_2178 (ccpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(2289449..2290450)
Genome map
AA seq 333 aa AA seqDB search
MTKLTAIAITLTAIFASSYAVAAEPIEVITPAKITEPEKVELGKMLFFEPRLSKSGFISC
NSCHNLSTGGVDALPTSIGHHWQEGPINSPTVLNADFMLAQFWDGRASNLKEQAAGPIAN
PKEMGFTHELATETIASMPAYRARFAKVYGDEKVDIDRLTDAIAAFEKTLVTPNSPFDQY
LLGKQDAISGDAKAGYQLFKDKGCVSCHNGPAVGGTMFMKMGLIKPFHTNNPAEGRKGVT
GKDADKFVFKVPTLRNIELTYPYFHDGSVWTLEEAVNTMADIQLGQKLTEKETKEMVAFL
NSLTGEQPQISLPILPPSNKETPRPVPFATGAK
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaactcaccgctatcgcgataaccctcacggctatattcgcaagtagctacgcc
gtcgccgccgaaccgattgaagtcattaccccagcaaaaatcactgaacccgagaaggtg
gaactgggcaaaatgctcttttttgaaccaagactgtctaaatcaggttttatttcctgt
aactcttgccacaacctttcaacgggcggcgtagatgcgctacccacgtcaattggtcat
cattggcaagaaggcccgattaactcaccgaccgtgctaaacgccgactttatgctggcg
caattctgggatggtcgcgccagcaacttaaaagagcaagccgcaggcccgattgccaac
cccaaagaaatgggctttacccatgaactcgccaccgaaaccattgcttccatgccagca
taccgcgcgcgctttgccaaagtttacggtgatgaaaaagtcgatattgaccgcttaacc
gatgccattgctgccttcgaaaagaccttagtcacgcctaatagcccattcgatcagtat
ttattgggtaaacaagatgcgattagcggcgacgctaaagctggctatcaactctttaaa
gataagggctgcgtcagttgccataatggccccgcggtaggcggtactatgtttatgaag
atgggcctaattaaacccttccataccaataaccctgccgaaggccgtaagggcgtaacg
ggtaaggatgcggataagtttgtgtttaaggtaccgacactgcgcaatattgaactaacc
tatccctacttccatgacggcagtgtatggacacttgaagaagcggtaaataccatggca
gatattcagttaggacaaaaactgaccgagaaggaaaccaaggaaatggtagcattctta
aattcactcacgggtgaacagccacagatctcgctgccgattctgccaccatcaaataaa
gagactccgcgcccagttccttttgcgacaggagcaaaataa

DBGET integrated database retrieval system