KEGG   Shewanella oneidensis: SO_2250Help
Entry
SO_2250           CDS       T00099                                 

Gene name
nagZ
Definition
beta-N-acetylglucosaminidase NagZ (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
son  Shewanella oneidensis
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:son00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:son00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2364238..2365266
Genome map
AA seq 342 aa AA seqDB search
MSYLMLDLLSLDVSEAEAEMLRHPQVGGLILFSRNFTSREQLIALVQQIRQIRPEILIAV
DHEGGRVQRFREGFTLIPAMGDILPAAKGDMALAKRWACELGFLMAIELLACDIDLSFAP
VLDLNGISQVIGKRSFSANPDEVIALARSFIEGMAQAGMGAVGKHFPGHGSVAADSHIAQ
PIDEREGEVIFNQDILPFKELIFNGKLSGIMPAHVIYPKVDPNPAGFSSYWLKQILRKEL
GFNGVIFSDDLGMKGASFAGDYVGRAKAALDAGCDMILVCNDNPGVMTLLNGFVWPEAAP
QHPASLLKPNMAQTALALENSARWENAKQLAEQIQLAQQAKV
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgagttatttaatgttggatctgctgtcattagatgtcagtgaggctgaagctgaaatg
ttgcgccatcctcaggtgggcggtttgatcctgttttcccgcaactttaccagtcgtgaa
caattaattgccttggtgcagcagatccgccaaattcgccccgagatattaatcgcggtt
gaccacgagggcgggcgggtgcagcgcttccgtgaaggatttactttaattcctgccatg
ggagatattctgcctgcggcgaagggggatatggctctcgcgaagcgatgggcctgtgag
ttgggctttttaatggctatcgagctactcgcctgcgatatcgatttaagttttgcgcct
gtgctcgaccttaacggtattagccaagtgattggtaaacgtagttttagcgcaaaccca
gatgaagtcatcgccttagcacggagttttattgaaggtatggcacaggccggaatgggc
gccgtgggcaaacatttccccggtcatggcagtgtggccgcggactcgcatattgctcaa
cctattgatgagcgtgagggtgaggtgatttttaatcaggatattttgccatttaaagag
ttgatttttaatggaaaattgtctggcattatgccagcacatgtgatttaccccaaagtt
gacccgaatcctgctggcttttcgtcttactggttaaagcagattttacgcaaagagctt
ggttttaacggggtaatcttctccgatgatctcggtatgaagggcgcctcctttgcgggt
gattatgtgggacgtgccaaagcagcattggatgcagggtgcgatatgatattggtttgt
aatgataatcctggcgtgatgacgttgctaaatggttttgtttggcctgaggctgcccca
caacatccggcgagcttgcttaaaccgaatatggcgcaaaccgctttagcgttagaaaat
agtgcccgttgggaaaatgctaagcagctagcggagcaaatacagctcgcacaacaggca
aaagtttga

DBGET integrated database retrieval system