KEGG   Shewanella oneidensis: SO_2327Help
Entry
SO_2327           CDS       T00099                                 

Gene name
cheB
Definition
chemotaxis signal transduction system response regulator with glutamate methylesterase domain CheB (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
son  Shewanella oneidensis
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:son02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:son02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2436784..2437854
Genome map
AA seq 356 aa AA seqDB search
MIKVAIVDDSAVVRQVLSSMLENQPDITLLGCARDPLFALKLFEQQWPDVIILDIEMPRM
DGITFLKKVMAEKPTPVVICSTLTEQGASVTIAALAAGAVDIITKPKLGLKGFLEESQAR
LLQAIRAAAKASVAKLRVNGLAKPMPVIAKHNADVVLASTNHALNQTTDRVVALGTSTGG
THALEYVLTALPRTSAGIVVVQHMPEHFTAAFASRLNGVCEMEVKEAEDNDRVMPGLVLI
ANGGKHMLLQRSGAQYRVQLKDGPLVSRHRPSVDVLFRSVANAAGKNALGVIMTGMGDDG
ARGLLEMHQCGAITLAQDEASCVVYGMPKEAVKLGAVSRQVALDNIAEEIIAFTKQ
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
gtgattaaggttgccatagtggatgattcggcggttgtcaggcaagtgcttagcagcatg
ttggaaaatcaaccggatattacgctattaggctgcgctcgggatcctctttttgctctc
aagttattcgaacagcaatggcctgatgtcattattctcgatattgaaatgccaagaatg
gacggcattacgtttttaaaaaaagtcatggccgaaaaaccaacaccagtggtgatttgc
tcaacattaactgagcaaggggcttcagtaaccattgcggcacttgccgctggggcggtg
gatatcattactaaacctaaattaggtttgaagggatttttggaggaatcacaagctcgt
ttactgcaggccattcgtgccgccgccaaagcctcggtagctaaattgcgtgttaatggc
ttagcaaaaccaatgcctgttatcgcaaaacacaacgccgatgtagtgctagcatcaaca
aaccatgcgttaaaccaaaccacagatcgtgttgttgccctcggaacctctacgggcgga
acccatgcacttgaatatgtgctaacggcgttgccccgcacaagtgcgggtatagtagtt
gtccaacatatgccagaacattttacggccgctttcgccagccggttaaatggggtatgt
gaaatggaagtaaaagaagccgaggataacgatagggtgatgccggggctcgtgcttatt
gccaatggtggtaaacatatgctgttacaacgtagcggggctcaatatcgtgttcaactg
aaggatgggccgctggtcagtcggcatcgcccctcggttgatgtattgtttcgttctgtt
gctaatgctgcaggtaaaaatgccttaggggttattatgactggcatgggtgacgatggc
gctcgggggttgctggaaatgcatcagtgcggagccataacattggcgcaggatgaagcc
agttgcgtggtttatggtatgccaaaagaagcggtcaaactcggcgcagtgagtcggcag
gttgctctggacaatattgctgaggaaattatcgcttttaccaagcaataa

DBGET integrated database retrieval system