KEGG   Shewanella oneidensis: SO_2459Help
Entry
SO_2459           CDS       T00099                                 

Gene name
cga
Definition
glucan 14-alpha-glucosidase Cga (EC:3.2.1.3)
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
son  Shewanella oneidensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:son00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SO_2459 (cga)
Enzymes [BR:son01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     SO_2459 (cga)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2575985..2578522
Genome map
AA seq 845 aa AA seqDB search
MPFTEQPKQDCGQLKQHSSSLTLKPIALAITASLIGLASLSACSPIADKSASSTTSNAVS
NNEINTASYNIAPGAPGKAPTWAFSGKTGIGTSYEPYTQGQYQDSQQNPISRVWFSIAQG
ILTETMFGLIHNAQLKELQFVITGNGFVDTEKDNTISSIEYLDTDANGRPQSLAYKIINR
DVEGKYQIEKHIFTDPGRDTLVMRVTFTAFEAGITPHLYVNPHIDNAGANDIGRIDHQAL
IAYTAAPHSSVMTVKSDINFVRATTGFEGISDGLADLADNGTLDTLYSATSAPDNRTQGN
IAFTASYPEVTPNQPLNINLAIGFGHDELSSLTNAKATLNAGYDAVLGQYNAGWRSYLQS
LPAIAGMAKSTTDNGKLLYTSAMVLKAQEDKTYAGALIASLSNPWGDTVSAITPSTGYKA
VWPRDFYQCAMAFLAMGDTQTPKVAFEYLKKVQVSDKTSGFSGTPGWFLQKTHVDGQIEW
VGVQLDQTAMPIMLGWKLWQAGGLSQTELSYWYQEMLKGAADFLVSGGEVNLDWNHTPVT
PPKTQQERWEEQAGFSPSTTAAVIAGLVTASDIAKAVNDLNASQRYLDSAKTLNQQLEKH
LVTTQGLLTDSQGVSTPYYLRLSPHGEPNTATKLAANNGKAGLDQRQILDAGFLELVRYG
VRGATDKLINQSLALVDNTKLEDNLRLKYSFTAKDGSSVPGFRRYGNDGYGEDTVTGANY
AESGGNSDNQRGRVWPFFTGERGHFELALASAKGELTGTKGQQTKQQLINTYVQGMETFA
NAGMMLPEQAWDGVGNATRYQYRLGQGTNSATPLAWTHAEYIKLVRSMNDGQLWDHYPIV
PETLK
NT seq 2538 nt NT seq  +upstreamnt  +downstreamnt
atgccatttaccgagcagcctaaacaagactgtggccaactcaagcaacacagtagcagt
ttaaccttaaagcccattgccttagcgatcacagccagccttatcggattggccagtttg
agcgcctgttcaccgatagcggataaatcggcttcatcaaccacctccaatgccgtatca
aataacgagataaacacggcaagctataacattgcccccggtgctcccggcaaagcgcca
acttgggcattctccggcaaaaccggtattggcacatcctatgagccttatacccaaggg
caatatcaagatagccagcaaaaccccattagccgggtgtggttctcgattgcgcagggg
attttaaccgagaccatgttcggccttatccacaatgctcagctcaaagaattgcaattt
gtgatcaccggcaatggctttgtcgataccgaaaaagacaataccatcagcagtattgaa
tatttagataccgatgccaatggccgaccgcaatccttggcctataagataatcaatcgt
gatgttgaaggtaagtatcagatagaaaaacatattttcaccgatccaggccgcgatacg
ttggtgatgcgcgtcacttttaccgcctttgaagcaggtatcacgccgcatttatacgtt
aatcctcatattgataatgcgggagccaatgatataggccgaatcgatcatcaagcgctt
atcgcctacaccgccgccccgcacagcagcgtgatgacggtcaaatccgatatcaacttt
gtgcgcgcaactacaggctttgagggtatctcagatgggcttgccgatttagccgacaac
ggcacactggataccctgtatagcgccacaagtgcgcccgataatcgtactcaaggcaat
atcgcctttaccgcgagttatccagaagtaacaccaaatcaaccgcttaacatcaattta
gcgattggatttggccacgatgagttaagcagcttaaccaatgccaaggctacgttaaat
gcaggttacgatgctgtgttaggtcaatacaacgctggatggcgcagttatttacagtca
ctgcccgcaatcgcagggatggcaaaaagcaccacagataatggcaaactgctctacacc
agcgccatggtactcaaagcgcaggaagataaaacctatgcaggcgcacttatcgcatca
ctatccaacccttggggtgataccgtctcggccatcacccccagtacaggttacaaggcc
gtttggccgcgcgacttttatcaatgcgcgatggcatttttggccatgggtgatacccaa
acccccaaagtcgccttcgaataccttaaaaaagtgcaagtgagtgataaaacctcaggc
tttagcggcacgcccggctggtttttacaaaagacccatgtggatggccaaattgaatgg
gtgggcgtacagcttgaccaaacggccatgcccattatgctcggctggaaactctggcaa
gcgggtgggctaagtcaaactgaactgagctattggtatcaagagatgttaaaaggcgcg
gcggactttttagtcagcggcggcgaggttaatcttgactggaaccacacgccagtcaca
ccgccaaaaacccagcaagaacgctgggaagaacaagcgggcttctcaccctccaccacg
gccgcggtgatcgcaggtttagtgacagcaagtgatattgccaaagcggtgaatgatctc
aatgccagccagcgctatttagattctgccaaaacgcttaatcaacagcttgaaaaacac
ttagtgacgacccaagggttgctcacggatagccaaggcgtgagtactccttattatctg
cgattaagcccccatggtgagccaaacactgcgactaaactggctgcaaataacggtaaa
gcgggattagatcaacgccagatcctcgatgcaggctttttagaactggtgcgctatggc
gtgcgtggcgcaaccgacaagctcatcaatcaaagtctggcacttgtagataacactaag
ctagaagacaatctacgcctcaaatatagctttaccgcaaaagacggcagcagtgttccg
ggctttaggcgttatggtaacgatggctatggcgaagacactgtcactggcgcgaactac
gctgaatcgggtggtaatagcgacaatcaacgcggccgagtatggcccttcttcaccggc
gagcggggacattttgaactggctttagcaagtgcaaagggggaattgactggcacgaaa
ggacagcaaaccaagcaacaacttatcaatacctatgtacaaggtatggaaacctttgct
aatgccggcatgatgctccccgagcaggcatgggatggtgttggtaacgccacacgttat
caatatcgactcggtcaaggcactaactctgccactccgcttgcttggactcacgctgaa
tatatcaagttagtgcgctcaatgaatgatggccaactgtgggatcattaccctattgtc
ccggagacgttgaaataa

DBGET integrated database retrieval system