KEGG   Shewanella oneidensis: SO_2471Help
Entry
SO_2471           CDS       T00099                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase DapE (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
son  Shewanella oneidensis
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:son01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:son00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2593062..2594216
Genome map
AA seq 384 aa AA seqDB search
MTDAAHSSQTGPVTELTKALIARPSVTPLDEGCQTLMAERLAAIGFNIEAMVFEDTTNMW
ARRGNTGPVFCFAGHTDVVPTGDLSRWHTPPFEPTIIDGYLYGRGAADMKGSLAAMVVAT
ERFVAKHPNHPGSIAFLITSDEEGPFINGTTRVIDTLEARNEKITWALVGEPSSTLKLGD
VVKNGRRGSLTANLTVKGVQGHVAYPHLADNPIHKAAPFLAELSQTHWDNGNAFFPPTSM
QIANINGGTGASNVIPGALEVMFNFRYSTEVTAEILIERVETLLTAHELDYDIRWTFNGL
PFLTGEGPLLDATRHAIRQVTGYDTDPQTTGGTSDGRFIAPTGAKVLELGPVNATIHKVN
ECVKVDDLEQLALCYEVILEQLLC
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgacagacgctgcgcactcttcgcaaactgggccggtaaccgaactgactaaagcgttg
atcgcccgcccttccgtcaccccgctggatgaaggctgccaaaccctgatggccgagcgt
cttgccgccataggatttaatattgaagctatggtctttgaagacaccaccaacatgtgg
gcacggcgtgggaataccggtccggtattttgttttgccggccataccgatgtcgtaccg
acaggcgatcttagccgctggcacacaccgccctttgagcccacgattattgacggttat
ctgtatggtcgcggcgctgccgatatgaaaggctcactcgccgccatggtcgtcgcaacc
gaacgttttgtggctaaacaccctaatcatcccggttcgatcgcttttttgatcaccagc
gatgaagaaggcccgtttatcaatggcaccactcgagttatcgataccttagaagcccgt
aatgagaaaatcacttgggcgctggtgggcgaaccctcgtcaaccttaaaactcggtgat
gtggttaaaaatggtcgccgtggtagtctcaccgccaacttaaccgttaaaggcgttcag
ggccatgtggcctatccgcaccttgcagataatcccatccacaaagccgcccccttttta
gccgaattaagccaaacccattgggataatggcaacgcattcttcccgccaaccagtatg
caaatcgccaatattaacggcggtacgggcgcatcgaacgtgatccctggcgccttagag
gtgatgtttaacttccgttattctaccgaagtgaccgccgagatattaatcgagcgcgtg
gagaccttattaacagcccatgaactggattacgacatccgttggactttcaatggcctg
ccatttttaactggcgaaggcccactgttagacgctacccgccatgctattcgtcaagtt
acgggctatgacaccgatccgcaaaccaccggcggcacctccgatgggcgctttattgcc
cccacaggcgccaaagtgttggaacttggccctgtgaacgccaccatccataaagtaaac
gagtgtgtgaaggtcgacgatctagagcaattagcactgtgttacgaagtgattttggaa
caattactgtgttaa

DBGET integrated database retrieval system