KEGG   Shewanella oneidensis: SO_2587Help
Entry
SO_2587           CDS       T00099                                 

Gene name
hemB
Definition
(RefSeq) delta-aminolevulinic acid dehydratase HemB
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
son  Shewanella oneidensis
Pathway
son00860  Porphyrin and chlorophyll metabolism
son01100  Metabolic pathways
son01110  Biosynthesis of secondary metabolites
son01120  Microbial metabolism in diverse environments
Module
son_M00121  Heme biosynthesis, glutamate => heme
son_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:son00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SO_2587 (hemB)
Enzymes [BR:son01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     SO_2587 (hemB)
Exosome [BR:son04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SO_2587 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD DUF3502
Motif
Other DBs
NCBI-GeneID: 1170289
NCBI-ProteinID: NP_718173
UniProt: Q8EE03
Position
2713797..2714798
Genome map
AA seq 333 aa AA seqDB search
MSSTRENTIAPLRRLRRLRRTEAMRDLVRETHVSLSDLIHPLFIEEHINQAVPISTLPGI
CRLPESALADEIQRLYALGIRYVMPFGISHTKDPQGSDTWNDNGLLARMIRTIKATAPEM
MVIPDICFCEYTDHGHCGVLHQDEVCNDQTVANLVKQSVTAAKAGADMLAPSAMMDGQIK
AIRQGLDEAGFEHVAILAHAAKFASSFYGPFRAAVDCELSGNRKGYQLDYANGRQALLEA
LLDEEEGADILMVKPGTPYLDVLSRLRQETHLPLAAYQVGGEYAGIKFAALAGALDERAV
VTETFIGLKRAGADLIVSYYTKQYAEWLAELRE
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcacacgagaaaataccatcgccccccttcgccgtttaagacgcctgcgccgc
accgaggccatgcgtgatctggtacgtgaaacccatgtctcactctccgacttgatccac
ccactctttattgaagaacacattaaccaagctgtgccaatttcaaccctgccggggatt
tgccgtctgcccgaaagcgcacttgccgatgagatccaaaggctctatgccttagggatc
cgctatgtgatgccctttgggatttcccataccaaagatccacagggcagcgacacttgg
aatgacaatggattgctcgcacggatgatccgtaccataaaagccaccgcgccagagatg
atggtgatccccgatatttgtttttgtgaatataccgaccatggacactgcggcgtgttg
caccaagacgaagtctgtaacgaccaaaccgtggctaacttagtcaaacaatccgtcacc
gccgctaaagcgggagctgatatgttggcgccatcagcaatgatggatggtcaaattaaa
gcgatacgacaagggctggatgaagcaggctttgaacacgtagccattttggcccacgca
gccaagttcgcctcctctttctacgggccttttagggccgctgtagattgtgaactcagt
ggtaaccgcaaaggctatcagctcgattacgccaatggccgccaagcattgctcgaagca
ctgctcgatgaggaagaaggcgcagatattttgatggtaaaacccggcacgccatatttg
gatgtattaagtcgcctaagacaagaaacccacctccccttagcggcctatcaagtgggt
ggcgaatatgcaggtattaaatttgctgcgctggcgggcgccctcgatgagcgcgccgtt
gtcactgaaacctttatcggtttaaaacgggctggtgccgatttaattgtcagttattac
actaaacaatatgccgagtggttagcagagttacgcgaataa

DBGET integrated database retrieval system