KEGG   Shewanella oneidensis: SO_2587Help
Entry
SO_2587           CDS       T00099                                 

Gene name
hemB
Definition
delta-aminolevulinic acid dehydratase HemB (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
son  Shewanella oneidensis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:son00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2713797..2714798
Genome map
AA seq 333 aa AA seqDB search
MSSTRENTIAPLRRLRRLRRTEAMRDLVRETHVSLSDLIHPLFIEEHINQAVPISTLPGI
CRLPESALADEIQRLYALGIRYVMPFGISHTKDPQGSDTWNDNGLLARMIRTIKATAPEM
MVIPDICFCEYTDHGHCGVLHQDEVCNDQTVANLVKQSVTAAKAGADMLAPSAMMDGQIK
AIRQGLDEAGFEHVAILAHAAKFASSFYGPFRAAVDCELSGNRKGYQLDYANGRQALLEA
LLDEEEGADILMVKPGTPYLDVLSRLRQETHLPLAAYQVGGEYAGIKFAALAGALDERAV
VTETFIGLKRAGADLIVSYYTKQYAEWLAELRE
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcacacgagaaaataccatcgccccccttcgccgtttaagacgcctgcgccgc
accgaggccatgcgtgatctggtacgtgaaacccatgtctcactctccgacttgatccac
ccactctttattgaagaacacattaaccaagctgtgccaatttcaaccctgccggggatt
tgccgtctgcccgaaagcgcacttgccgatgagatccaaaggctctatgccttagggatc
cgctatgtgatgccctttgggatttcccataccaaagatccacagggcagcgacacttgg
aatgacaatggattgctcgcacggatgatccgtaccataaaagccaccgcgccagagatg
atggtgatccccgatatttgtttttgtgaatataccgaccatggacactgcggcgtgttg
caccaagacgaagtctgtaacgaccaaaccgtggctaacttagtcaaacaatccgtcacc
gccgctaaagcgggagctgatatgttggcgccatcagcaatgatggatggtcaaattaaa
gcgatacgacaagggctggatgaagcaggctttgaacacgtagccattttggcccacgca
gccaagttcgcctcctctttctacgggccttttagggccgctgtagattgtgaactcagt
ggtaaccgcaaaggctatcagctcgattacgccaatggccgccaagcattgctcgaagca
ctgctcgatgaggaagaaggcgcagatattttgatggtaaaacccggcacgccatatttg
gatgtattaagtcgcctaagacaagaaacccacctccccttagcggcctatcaagtgggt
ggcgaatatgcaggtattaaatttgctgcgctggcgggcgccctcgatgagcgcgccgtt
gtcactgaaacctttatcggtttaaaacgggctggtgccgatttaattgtcagttattac
actaaacaatatgccgagtggttagcagagttacgcgaataa

DBGET integrated database retrieval system