KEGG   Shewanella oneidensis: SO_2769Help
Entry
SO_2769           CDS       T00099                                 

Definition
(RefSeq) aldose 1-epimerase
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
son  Shewanella oneidensis
Pathway
son00010  Glycolysis / Gluconeogenesis
son01100  Metabolic pathways
son01110  Biosynthesis of secondary metabolites
son01120  Microbial metabolism in diverse environments
son01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:son00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SO_2769
Enzymes [BR:son01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     SO_2769
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-GeneID: 1170470
NCBI-ProteinID: NP_718350
UniProt: Q8EDI0
Position
2893078..2893926
Genome map
AA seq 282 aa AA seqDB search
MGSVTTKKHANGLDYVEVNTALCQARIFLQGAQIDHFQPVGKPPLLWVSSADDYQPGNGI
RGGVPVCWPWFGMSSEANFPQHGFARTRVWALESVEMRNQLVDLRFSLTISEEDKVFWPH
NTQVNVLFTLGETLSISLINTNLGDVPVSLTQALHSYFPIEDIHQLKATGFSGAQYIEFA
KGPYPQTTDDVLFDRETDRVYTNLGPVQHLHTPKGIIEVSRENSRSAVLWNPWIEKSTRL
ARFNDNDYLTMVCLEAANVLEDKLTLAPGESHSLITHIRWAD
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgggttctgttaccaccaaaaaacacgcaaacgggctcgattatgtcgaagtgaacacg
gcattatgccaagcgagaatttttttacagggcgcgcaaatcgaccattttcaacctgtc
ggtaagcccccattgttatgggtttcctccgccgatgactatcaacccggaaatgggatc
cgtggtggtgtacctgtatgttggccatggtttggcatgagcagtgaagccaatttccca
caacacggttttgctcgcacccgagtttgggcgctagaatcagttgagatgcgtaatcaa
ttggtggatttgcgtttcagcttaaccatcagcgaagaagataaggtcttttggccgcac
aatacccaagtcaacgtactctttaccttaggtgaaacgttaagtatcagcttgattaat
accaaccttggtgatgtacccgtgagcctcactcaagcgctacacagctattttccgatt
gaagatattcaccagcttaaagcgacaggatttagcggtgctcaatatattgagtttgct
aaaggcccatacccgcaaaccacagatgacgtgttatttgaccgtgaaaccgaccgcgtt
tacaccaacctaggcccagtacaacacttacatacgccaaaaggtataattgaagtaagc
cgtgagaatagccgctcggcggtgctgtggaacccgtggattgaaaaatcgacccggctt
gcccgcttcaatgacaatgactatctgaccatggtgtgtttagaagccgccaatgtgctt
gaagataagctcactctcgctcctggtgaaagccacagccttatcacccatattcgctgg
gcagactaa

DBGET integrated database retrieval system