KEGG   Shewanella oneidensis: SO_2769Help
Entry
SO_2769           CDS       T00099                                 

Definition
aldose 1-epimerase (EC:5.1.3.3)
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
son  Shewanella oneidensis
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:son00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2893078..2893926
Genome map
AA seq 282 aa AA seqDB search
MGSVTTKKHANGLDYVEVNTALCQARIFLQGAQIDHFQPVGKPPLLWVSSADDYQPGNGI
RGGVPVCWPWFGMSSEANFPQHGFARTRVWALESVEMRNQLVDLRFSLTISEEDKVFWPH
NTQVNVLFTLGETLSISLINTNLGDVPVSLTQALHSYFPIEDIHQLKATGFSGAQYIEFA
KGPYPQTTDDVLFDRETDRVYTNLGPVQHLHTPKGIIEVSRENSRSAVLWNPWIEKSTRL
ARFNDNDYLTMVCLEAANVLEDKLTLAPGESHSLITHIRWAD
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgggttctgttaccaccaaaaaacacgcaaacgggctcgattatgtcgaagtgaacacg
gcattatgccaagcgagaatttttttacagggcgcgcaaatcgaccattttcaacctgtc
ggtaagcccccattgttatgggtttcctccgccgatgactatcaacccggaaatgggatc
cgtggtggtgtacctgtatgttggccatggtttggcatgagcagtgaagccaatttccca
caacacggttttgctcgcacccgagtttgggcgctagaatcagttgagatgcgtaatcaa
ttggtggatttgcgtttcagcttaaccatcagcgaagaagataaggtcttttggccgcac
aatacccaagtcaacgtactctttaccttaggtgaaacgttaagtatcagcttgattaat
accaaccttggtgatgtacccgtgagcctcactcaagcgctacacagctattttccgatt
gaagatattcaccagcttaaagcgacaggatttagcggtgctcaatatattgagtttgct
aaaggcccatacccgcaaaccacagatgacgtgttatttgaccgtgaaaccgaccgcgtt
tacaccaacctaggcccagtacaacacttacatacgccaaaaggtataattgaagtaagc
cgtgagaatagccgctcggcggtgctgtggaacccgtggattgaaaaatcgacccggctt
gcccgcttcaatgacaatgactatctgaccatggtgtgtttagaagccgccaatgtgctt
gaagataagctcactctcgctcctggtgaaagccacagccttatcacccatattcgctgg
gcagactaa

DBGET integrated database retrieval system