KEGG   Shewanella oneidensis: SO_2928Help
Entry
SO_2928           CDS       T00099                                 

Gene name
tesA
Definition
multifunctional thioesterase/protease/lysophospholipase L1 TesA (EC:3.1.2.2 3.1.1.5)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
son  Shewanella oneidensis
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:son00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    SO_2928 (tesA)
Enzymes [BR:son01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     SO_2928 (tesA)
   3.1.2  Thioester hydrolases
    3.1.2.-  
     SO_2928 (tesA)
Lipid biosynthesis proteins [BR:son01004]
 Fatty acid synthase
  Component type
   SO_2928 (tesA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3060370..3060969
Genome map
AA seq 199 aa AA seqDB search
MAKALVICILLSLCVTTPVQAAKVLILGDSLGASYGMSEQLGWVALLQKNLPEHDFTNGS
VSGETTAGGLRRLPALLDSVAPDLVVVELGGNDGLRGFPPTQLKNNLTQIITLAKNSGAK
VLLTEIMVPPNYGPRYTQKFTEVYQEIAKDEDIPLIPFFMQEIAPYPELMQRDGIHPNEK
AQDKIANWMQPWIEKALTQ
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaagccttggtgatctgcatcctgttaagtctgtgtgttaccacgccagttcag
gcggcgaaagtgttgatcctcggcgatagcttaggtgcaagctacggcatgtcggaacaa
ctaggctgggtggcgctgctgcaaaaaaacttacccgagcatgactttaccaatggttcg
gtgagcggtgaaaccacagcgggcggtttgcgtcgcttgcctgccctgcttgattccgtt
gcacccgatttagtggtagtcgaactcggcggtaacgatggtttacgtggattccccccg
acgcaacttaaaaataacctaacccaaatcattaccctagccaaaaatagcggtgccaaa
gtgctactgaccgaaatcatggtaccgcctaactatggccctcgctacacccaaaagttc
accgaagtgtatcaagagattgccaaggatgaggatatcccgctgatccccttctttatg
caggagatcgctccctaccctgaactgatgcaaagagatggcattcatcccaatgaaaag
gcccaagataaaattgccaattggatgcaaccttggattgaaaaagcgttaacgcaataa

DBGET integrated database retrieval system