KEGG   Shewanella oneidensis: SO_3022Help
Entry
SO_3022           CDS       T00099                                 

Gene name
trpCF
Definition
bifunctional indole-3-glycerolphosphate synthetase/phosphoribosylanthranilate isomerase TrpCF (EC:4.1.1.48 5.3.1.24)
Orthology
K13498  
indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
son  Shewanella oneidensis
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:son00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SO_3022 (trpCF)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SO_3022 (trpCF)
Enzymes [BR:son01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     SO_3022 (trpCF)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     SO_3022 (trpCF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3133254..3134750
Genome map
AA seq 498 aa AA seqDB search
MTQTQSATALGKSQDKQQDNQASQDVRGTMQTSTTQANVLTRIVDTKAAHIAALKLRFPE
ASLVPKVSDRSLFAALKAPKAGYILECKKASPSKGLIRKDFDVEAIASIYTKYAAGISVL
TDEQFFQGDMDYIPKVRAKVSQPILCKDFFVDEYQVKLAAHQGADAILLMLSVLDDERYQ
QLASEAAKYQLDVLTEISNEEELKRAIALNAPIIGINNRNLRDLSTDLATTEALAPHIGS
DRVVISESGIYTNDQVRRLSPLVDGFLVGSSIMAEEDIDLACRKLIFGHNKVCGLTRLED
IEAAANAGAVYAGLIFAEKSPRALTKDAAKQLVEQYRAAKLPAIEFVGVFVNNTPKLIAS
IAKACDLAAVQLHGSETELEITELSQLLQQAGLKTHIWKAVSVDATSGELGAMPKGVQRY
LFDSKNNAGFGGTGQPFNWHLPLAHKAKALLAGGLNAANAANANAQGFYGLDFNSGLETA
PGIKSAEQIQTAFAQLRL
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgacacaaactcaatcagccaccgccttaggtaaatcacaagacaaacaacaagataac
caagcatctcaagatgtgaggggcacgatgcaaaccagtaccacccaggcgaatgtctta
acccgtattgtcgacactaaagccgcccatattgcagcccttaaactgcgttttcctgag
gcaagcttagtccccaaagtctctgaccgaagcctatttgccgccctcaaagcgccgaag
gcgggttatattttagaatgcaaaaaagccagcccctccaaagggttaatccgtaaagac
tttgatgtcgaagccatcgcatcgatttatacaaaatatgccgcggggatctcggtatta
accgatgagcaatttttccaaggtgatatggactatatccctaaagtgcgagcaaaagtg
agccaaccgattctgtgtaaagacttttttgttgatgagtaccaagtcaaattggctgcc
catcaaggcgccgatgcgattctgttaatgctctctgtgctcgatgatgagcgataccag
caacttgccagcgaagcggccaagtatcaactcgatgtactgacagagatcagcaatgaa
gaagaacttaagcgcgccatcgccttgaatgcaccgattattggcattaataaccgtaac
ttacgagatttaagtaccgatcttgccaccactgaggccttagcgccccatattggcagt
gatcgcgtggttatcagcgaatcgggtatttacactaacgatcaagtgcgtcgcttaagc
ccactggtcgatggcttcttggtaggtagctcaattatggccgaagaagatattgattta
gcctgtcgtaaattgatcttcggtcacaataaagtctgcggcctcactcgccttgaggat
attgaagcggcggccaatgcgggcgccgtttatgcaggactcatttttgctgaaaaatca
ccacgcgcactcacaaaagatgccgccaaacagttagtcgagcaataccgcgcagccaaa
ttgcccgccattgaatttgttggggtatttgttaacaacacgcctaagctaatcgcaagt
attgccaaagcatgtgatttggccgcagtgcaactgcacggcagtgaaaccgagttagaa
attactgagctgagccaattgttacaacaagcaggacttaagactcacatttggaaagcg
gtcagtgttgacgccaccagcggcgaactcggtgccatgccaaaaggagtacagcgttat
ctgtttgatagtaaaaataatgcagggtttggtggcacggggcagccctttaattggcac
ttacctcttgcccataaagcaaaagccttactggcgggcggtcttaatgcagctaatgcc
gccaacgcgaatgcccaaggattttacggtttagattttaattccggcctcgaaaccgcc
cccggcattaaatctgcagaacagatccaaacagcctttgcccaattaaggctctga

DBGET integrated database retrieval system