KEGG   Shewanella oneidensis: SO_3023Help
Entry
SO_3023           CDS       T00099                                 

Gene name
trpB
Definition
(RefSeq) tryptophan synthase beta subunit TrpB (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
son  Shewanella oneidensis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:son00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SO_3023 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SO_3023 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SO_3023 (trpB)
Enzymes [BR:son01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SO_3023 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3134870..3136060
Genome map
AA seq 396 aa AA seqDB search
MSQLKLNPYFGEYGGMYVPQILVPALKQLESAFVEAQTDESFQAEFTDLLKNYAGRPTAL
TLTRNLSPNPMVKIYLKREDLLHGGAHKTNQVLGQALLAKRMGKKEIIAETGAGQHGVAT
ALACALLGLKCKVYMGAKDVARQSPNVFRMRLMGAEVIPVTSGSATLKDACNEAMRDWSG
SYEKAHYLLGTAAGPHPFPTIVREFQRIIGEETKKQILEREGRLPDAVIACVGGGSNAIG
MFADFIDETNVELIGVEPAGKGIDTHMHGAPLKHGKTGIFFGMKAPLMQDSEGQIEESYS
ISAGLDFPSVGPQHAHLNAIGRARYESATDDEALEAFQLLARCEGIIPALESAHALAYAL
RLAKECTKETILVVNLSGRGDKDIFTVSDILNGKEE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgtcacagttaaagcttaacccttatttcggcgaatacggtggtatgtatgtaccacag
attttagtcccagccctcaagcaactcgaaagtgcctttgttgaagcgcaaaccgatgag
tccttccaagccgagtttaccgacttactgaaaaactacgcgggccgccctactgcgctc
accttaacccgcaatttaagccccaatcccatggtaaaaatctacctcaagcgggaagat
ttactccacggcggcgcacataaaaccaaccaagtgctaggccaagcgttactggctaaa
cgtatgggtaaaaaggaaattattgccgaaaccggcgcaggccaacacggtgttgccacc
gcacttgcctgtgcactgctgggattaaaatgcaaagtgtatatgggcgcgaaagacgtt
gcccgccaatcacccaacgtatttagaatgcggctgatgggcgccgaggttatccctgtg
acctctggttctgccaccttgaaagatgcctgtaacgaggcgatgcgcgactggtctggc
agttacgaaaaagcccactatctgctcggcacagctgctgggccacatccgtttccgacc
atagtgcgtgaattccaacgtattattggtgaagaaaccaaaaaacaaatacttgagcgc
gaaggtcgcctgcccgatgcagtcatcgcctgtgtcggcggcggttccaatgctatcggt
atgtttgccgactttatagatgaaaccaatgtcgagctgattggggtcgagcctgcgggt
aaaggtattgatacccatatgcatggcgcgccgttaaagcacggtaaaacggggattttc
tttggcatgaaagccccactcatgcaggacagcgagggccaaatcgaagaatcttactcg
atttcagcaggattagacttcccctcggtcggcccacagcatgcccatttgaacgccatc
ggccgcgcccgttatgaatcggccaccgacgatgaagccctcgaagccttccaattactg
gctcgctgtgaagggattattccggcactcgaatcggcccacgccctcgcctatgcactg
cgtctggcgaaagagtgcaccaaagaaaccattttggttgtcaacctctcaggccgaggc
gataaggatattttcactgtgtcagacattttaaatggtaaagaggaataa

DBGET integrated database retrieval system