KEGG   Shewanella oneidensis: SO_3023Help
Entry
SO_3023           CDS       T00099                                 

Gene name
trpB
Definition
(RefSeq) tryptophan synthase beta subunit TrpB
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
son  Shewanella oneidensis
Pathway
son00260  Glycine, serine and threonine metabolism
son00400  Phenylalanine, tyrosine and tryptophan biosynthesis
son01100  Metabolic pathways
son01110  Biosynthesis of secondary metabolites
son01130  Biosynthesis of antibiotics
son01230  Biosynthesis of amino acids
Module
son_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:son00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SO_3023 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SO_3023 (trpB)
Enzymes [BR:son01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SO_3023 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-GeneID: 1170710
NCBI-ProteinID: NP_718591
UniProt: Q8ECV0
Position
3134870..3136060
Genome map
AA seq 396 aa AA seqDB search
MSQLKLNPYFGEYGGMYVPQILVPALKQLESAFVEAQTDESFQAEFTDLLKNYAGRPTAL
TLTRNLSPNPMVKIYLKREDLLHGGAHKTNQVLGQALLAKRMGKKEIIAETGAGQHGVAT
ALACALLGLKCKVYMGAKDVARQSPNVFRMRLMGAEVIPVTSGSATLKDACNEAMRDWSG
SYEKAHYLLGTAAGPHPFPTIVREFQRIIGEETKKQILEREGRLPDAVIACVGGGSNAIG
MFADFIDETNVELIGVEPAGKGIDTHMHGAPLKHGKTGIFFGMKAPLMQDSEGQIEESYS
ISAGLDFPSVGPQHAHLNAIGRARYESATDDEALEAFQLLARCEGIIPALESAHALAYAL
RLAKECTKETILVVNLSGRGDKDIFTVSDILNGKEE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgtcacagttaaagcttaacccttatttcggcgaatacggtggtatgtatgtaccacag
attttagtcccagccctcaagcaactcgaaagtgcctttgttgaagcgcaaaccgatgag
tccttccaagccgagtttaccgacttactgaaaaactacgcgggccgccctactgcgctc
accttaacccgcaatttaagccccaatcccatggtaaaaatctacctcaagcgggaagat
ttactccacggcggcgcacataaaaccaaccaagtgctaggccaagcgttactggctaaa
cgtatgggtaaaaaggaaattattgccgaaaccggcgcaggccaacacggtgttgccacc
gcacttgcctgtgcactgctgggattaaaatgcaaagtgtatatgggcgcgaaagacgtt
gcccgccaatcacccaacgtatttagaatgcggctgatgggcgccgaggttatccctgtg
acctctggttctgccaccttgaaagatgcctgtaacgaggcgatgcgcgactggtctggc
agttacgaaaaagcccactatctgctcggcacagctgctgggccacatccgtttccgacc
atagtgcgtgaattccaacgtattattggtgaagaaaccaaaaaacaaatacttgagcgc
gaaggtcgcctgcccgatgcagtcatcgcctgtgtcggcggcggttccaatgctatcggt
atgtttgccgactttatagatgaaaccaatgtcgagctgattggggtcgagcctgcgggt
aaaggtattgatacccatatgcatggcgcgccgttaaagcacggtaaaacggggattttc
tttggcatgaaagccccactcatgcaggacagcgagggccaaatcgaagaatcttactcg
atttcagcaggattagacttcccctcggtcggcccacagcatgcccatttgaacgccatc
ggccgcgcccgttatgaatcggccaccgacgatgaagccctcgaagccttccaattactg
gctcgctgtgaagggattattccggcactcgaatcggcccacgccctcgcctatgcactg
cgtctggcgaaagagtgcaccaaagaaaccattttggttgtcaacctctcaggccgaggc
gataaggatattttcactgtgtcagacattttaaatggtaaagaggaataa

DBGET integrated database retrieval system