KEGG   Shewanella oneidensis: SO_3024Help
Entry
SO_3024           CDS       T00099                                 

Gene name
trpA
Definition
(RefSeq) tryptophan synthase alpha subunit TrpA
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
son  Shewanella oneidensis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:son00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SO_3024 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SO_3024 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SO_3024 (trpA)
Enzymes [BR:son01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SO_3024 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
3136066..3136902
Genome map
AA seq 278 aa AA seqDB search
MNSISNQTIPHQASRYQAAFSRLKAEGRGAFVPFVTLGDPSPELSLKIIDTLVQNGADAL
ELGFPFSDPLADGPVIQGANLRALAAGTTPTACFELLAKIRAKYPELPIGLLLYANLVFA
NGIDAFYAKAQQAGVDSVLIADVPVEEAAPFIQAAKAHGIAPIFIAPPNADSDTLAKVSQ
SGEGYTYLLSRAGVTGADTKAGTPVEEILAKLQEFNAPPPLLGFGIAEPAQVSAAIKAGA
AGAISGSAVVKIIETHQQDEVKLLAALGEFTRTMKAAT
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgaacagcatttcaaaccaaactatccctcatcaagccagccgttatcaagcagcgttt
agccgtttaaaagccgaaggccgtggcgcctttgtgccctttgtcaccttaggcgatcca
agccctgagctgtcacttaagattatcgacaccctagtgcaaaacggtgccgatgcgctg
gagttaggctttcctttctctgatccgctcgccgatggccccgtgatccaaggcgcaaac
ctcagagccttagccgctggcacaacgccaacagcctgctttgaattgctggccaagatc
cgcgctaaataccctgaacttcccataggtttattactgtatgcgaacctcgtattcgcc
aatgggatcgatgctttttatgctaaagcgcagcaagcgggcgtggattcagtgttaatt
gccgatgtgccagttgaagaagccgcgccttttattcaagctgccaaagcccatggcatt
gcgccaatttttattgcgccgcccaatgccgacagcgacacccttgcgaaggtcagccaa
agtggtgaaggttatacttatttgctgtcgcgcgctggcgtaacgggtgccgacactaaa
gcaggtacgcctgtcgaagagatattagccaaattacaagagtttaatgccccgccgccg
ctgttaggctttgggattgcagagcctgcccaggtgagcgccgccatcaaagcgggcgct
gcaggcgcaatctctggctctgcggtggtgaaaattatcgaaactcatcaacaggatgaa
gtgaaactgctcgcagcattaggcgaatttacccgcacaatgaaagcggcaacctaa

DBGET integrated database retrieval system