KEGG   Shewanella oneidensis: SO_3088Help
Entry
SO_3088           CDS       T00099                                 

Gene name
fadJ
Definition
anaerobic fatty oxidation complex alpha subunit FadJ (EC:4.2.1.17 5.1.2.3 1.1.1.35)
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
son  Shewanella oneidensis
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:son00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SO_3088 (fadJ)
   01212 Fatty acid metabolism
    SO_3088 (fadJ)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SO_3088 (fadJ)
   00650 Butanoate metabolism
    SO_3088 (fadJ)
  Lipid metabolism
   00071 Fatty acid degradation
    SO_3088 (fadJ)
   01040 Biosynthesis of unsaturated fatty acids
    SO_3088 (fadJ)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SO_3088 (fadJ)
   00310 Lysine degradation
    SO_3088 (fadJ)
   00380 Tryptophan metabolism
    SO_3088 (fadJ)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SO_3088 (fadJ)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SO_3088 (fadJ)
   00281 Geraniol degradation
    SO_3088 (fadJ)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    SO_3088 (fadJ)
Enzymes [BR:son01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     SO_3088 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SO_3088 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     SO_3088 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3210696..3212813)
Genome map
AA seq 705 aa AA seqDB search
MGKTFNLTRREDGIAILTMDVPGETMNTLKAEFGPEISEILSEIKRDSSIRGLVLISGKK
DSFVAGADISMLDACQTAGDAKALSQQGHVVFNELEALNIPVVAAIHGACLGGGLELALA
CHQRVCSDDGKTMLGVPEVQLGLLPGGGGTQRLPRLVGITTALDMMLTGKQIRPKQALKM
GLVNDVVPQTILLQTAVEMALAGKQIAKPVKKSLVNQLLEGTGFGRNIIFDQAAKQVAKK
TQGNYPAPAKIIDCVRQGIAKGMQKGLEVEASHFAELVVSKESEALRSIFFATTEMKKET
GAEGATPRKVKKAVILGGGLMGGGIASVTTTKAKIPARVKDINEKGLSNALSYAYKLLDK
GVKRRHMTPAARDNLMALMTTTTEYKGVKDADIVVEAVFEDLALKHQMVKDIERECGEHT
IFASNTSSLPIGQIAQAASRPENVIGLHYFSPVEKMPLVEVIAHAKTSPETIATTVAFAR
KQGKTPIVVQDGAGFYVNRILALYMNEAAQLLLEGQSVEHLDKALVKFGFPVGPITLLDE
VGIDVGAKISPILEKELGERFKAPAAFDKLLSDDRKGRKNGKGFYQYGAASKKKAVDETV
YGVLGIKPGVDKEMSAVAERCVVQMLNEAVRCLDAGIIASPRDGDIGAIFGIGFPPFLGG
PFHYIDTLGADNLVKILERYQTQYGDRFEPCQRLKAMAAEKARFF
NT seq 2118 nt NT seq  +upstreamnt  +downstreamnt
gtgggaaaaacatttaatttaactcgccgtgaagacggtatcgccattttaaccatggac
gtacctggcgaaaccatgaataccctcaaggcggagtttggccctgagatcagtgagatc
ctgtctgagattaaacgcgattcgagtatccgtggcctagtgctgatttcgggcaaaaaa
gattcatttgttgccggtgccgatatctctatgctcgatgcttgccaaacggcgggcgat
gccaaagcgttatcccagcaagggcatgtggtgtttaacgagttggaagcattaaacatc
cctgtggtcgctgcaattcatggtgcttgcttgggcggcggtttagagctagcgcttgcc
tgccatcaacgtgtgtgcagtgatgatggcaagaccatgctgggcgtacctgaagtgcag
ctcggtttattacccggtggcggtggtacccagcgtttgccacgcttggtggggattacc
actgcgctggatatgatgttgacgggtaaacaaattcgcccgaaacaagcgttaaagatg
ggcttagttaacgatgtggtgccacaaacgattttgctgcaaaccgcagtggagatggcg
ctcgcgggtaaacaaatagctaagccagttaaaaaatcgctagtaaaccaattgcttgaa
ggtactggctttggtcgcaacattattttcgatcaagcggctaagcaagttgctaagaaa
acccaaggtaactacccagcgccagcaaagattattgattgtgtgcgccaaggtattgcc
aaaggtatgcagaagggactggaagtcgaagccagccattttgctgagctggtggtgtcg
aaagaatctgaagcgctgcgcagtattttctttgcaactacagagatgaagaaagaaacc
ggcgccgaaggtgcaacgccacgtaaagtcaaaaaagccgtgatcttaggtggcggtttg
atgggaggtggtattgcctctgtcactacgactaaggctaaaattcctgcgcgagtaaaa
gacattaacgaaaagggcttaagcaacgcgctttcttacgcctataagttattggataaa
ggcgtgaaacgtcgtcatatgacgccagccgctcgcgacaatttaatggcgctgatgaca
acgacgaccgaatataaaggtgttaaggatgccgatattgttgttgaagcggtatttgag
gatttagcgcttaaacatcaaatggttaaagatattgagcgtgaatgcggtgagcacacg
atttttgcgtctaacacctcatcgttacccattggtcaaattgcacaagcggcaagccgt
cctgaaaatgtgattggcttacattacttctcaccggtagaaaaaatgccgctggtggaa
gtgattgcccacgctaaaacctcaccagaaaccattgccaccacagtcgcctttgcccgt
aaacagggtaaaacgccaattgtggtacaagacggtgcggggttttatgttaaccgcatc
ctcgcgctttatatgaacgaagccgcacaattgctgctagaagggcaaagtgttgaacat
ctcgataaagcgttagtgaagtttggtttccccgttggcccaattaccttactcgatgaa
gtcggtattgatgtgggcgctaagatctctccaattcttgaaaaagagcttggtgaacgc
tttaaagcaccagcagccttcgacaagctattaagcgacgatagaaaaggtcgtaaaaat
ggcaaaggtttctatcagtatggcgctgccagcaagaaaaaagctgtggatgaaaccgtg
tatggcgtattaggtatcaagcctggtgtcgataaagaaatgagcgcggtagcggaacgc
tgtgtagtgcaaatgctgaatgaagcagtgcgctgcttagatgcaggcattattgcctcg
ccgcgcgatggtgatattggcgctatctttggcatcggcttcccaccattcttgggtgga
ccattccattatatcgatactttaggcgcggataacttagtcaaaatacttgaacgttat
caaacacaatatggcgatcgatttgagccttgccaacggcttaaggctatggcggcagaa
aaagctcgcttcttctaa

DBGET integrated database retrieval system