KEGG   Shewanella oneidensis: SO_3088Help
Entry
SO_3088           CDS       T00099                                 

Gene name
fadJ
Definition
(RefSeq) anaerobic fatty oxidation complex alpha subunit FadJ
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
son  Shewanella oneidensis
Pathway
son00071  Fatty acid degradation
son00280  Valine, leucine and isoleucine degradation
son00281  Geraniol degradation
son00310  Lysine degradation
son00362  Benzoate degradation
son00380  Tryptophan metabolism
son00410  beta-Alanine metabolism
son00640  Propanoate metabolism
son00650  Butanoate metabolism
son00903  Limonene and pinene degradation
son00930  Caprolactam degradation
son01040  Biosynthesis of unsaturated fatty acids
son01100  Metabolic pathways
son01110  Biosynthesis of secondary metabolites
son01120  Microbial metabolism in diverse environments
son01130  Biosynthesis of antibiotics
son01200  Carbon metabolism
son01212  Fatty acid metabolism
Module
son_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:son00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SO_3088 (fadJ)
   00650 Butanoate metabolism
    SO_3088 (fadJ)
  Lipid metabolism
   00071 Fatty acid degradation
    SO_3088 (fadJ)
   01040 Biosynthesis of unsaturated fatty acids
    SO_3088 (fadJ)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SO_3088 (fadJ)
   00310 Lysine degradation
    SO_3088 (fadJ)
   00380 Tryptophan metabolism
    SO_3088 (fadJ)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SO_3088 (fadJ)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SO_3088 (fadJ)
   00281 Geraniol degradation
    SO_3088 (fadJ)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SO_3088 (fadJ)
   00930 Caprolactam degradation
    SO_3088 (fadJ)
Enzymes [BR:son01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     SO_3088 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SO_3088 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     SO_3088 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 LEM
Motif
Other DBs
NCBI-GeneID: 1170773
NCBI-ProteinID: NP_718651
UniProt: Q8ECP7
Position
complement(3210696..3212813)
Genome map
AA seq 705 aa AA seqDB search
MGKTFNLTRREDGIAILTMDVPGETMNTLKAEFGPEISEILSEIKRDSSIRGLVLISGKK
DSFVAGADISMLDACQTAGDAKALSQQGHVVFNELEALNIPVVAAIHGACLGGGLELALA
CHQRVCSDDGKTMLGVPEVQLGLLPGGGGTQRLPRLVGITTALDMMLTGKQIRPKQALKM
GLVNDVVPQTILLQTAVEMALAGKQIAKPVKKSLVNQLLEGTGFGRNIIFDQAAKQVAKK
TQGNYPAPAKIIDCVRQGIAKGMQKGLEVEASHFAELVVSKESEALRSIFFATTEMKKET
GAEGATPRKVKKAVILGGGLMGGGIASVTTTKAKIPARVKDINEKGLSNALSYAYKLLDK
GVKRRHMTPAARDNLMALMTTTTEYKGVKDADIVVEAVFEDLALKHQMVKDIERECGEHT
IFASNTSSLPIGQIAQAASRPENVIGLHYFSPVEKMPLVEVIAHAKTSPETIATTVAFAR
KQGKTPIVVQDGAGFYVNRILALYMNEAAQLLLEGQSVEHLDKALVKFGFPVGPITLLDE
VGIDVGAKISPILEKELGERFKAPAAFDKLLSDDRKGRKNGKGFYQYGAASKKKAVDETV
YGVLGIKPGVDKEMSAVAERCVVQMLNEAVRCLDAGIIASPRDGDIGAIFGIGFPPFLGG
PFHYIDTLGADNLVKILERYQTQYGDRFEPCQRLKAMAAEKARFF
NT seq 2118 nt NT seq  +upstreamnt  +downstreamnt
gtgggaaaaacatttaatttaactcgccgtgaagacggtatcgccattttaaccatggac
gtacctggcgaaaccatgaataccctcaaggcggagtttggccctgagatcagtgagatc
ctgtctgagattaaacgcgattcgagtatccgtggcctagtgctgatttcgggcaaaaaa
gattcatttgttgccggtgccgatatctctatgctcgatgcttgccaaacggcgggcgat
gccaaagcgttatcccagcaagggcatgtggtgtttaacgagttggaagcattaaacatc
cctgtggtcgctgcaattcatggtgcttgcttgggcggcggtttagagctagcgcttgcc
tgccatcaacgtgtgtgcagtgatgatggcaagaccatgctgggcgtacctgaagtgcag
ctcggtttattacccggtggcggtggtacccagcgtttgccacgcttggtggggattacc
actgcgctggatatgatgttgacgggtaaacaaattcgcccgaaacaagcgttaaagatg
ggcttagttaacgatgtggtgccacaaacgattttgctgcaaaccgcagtggagatggcg
ctcgcgggtaaacaaatagctaagccagttaaaaaatcgctagtaaaccaattgcttgaa
ggtactggctttggtcgcaacattattttcgatcaagcggctaagcaagttgctaagaaa
acccaaggtaactacccagcgccagcaaagattattgattgtgtgcgccaaggtattgcc
aaaggtatgcagaagggactggaagtcgaagccagccattttgctgagctggtggtgtcg
aaagaatctgaagcgctgcgcagtattttctttgcaactacagagatgaagaaagaaacc
ggcgccgaaggtgcaacgccacgtaaagtcaaaaaagccgtgatcttaggtggcggtttg
atgggaggtggtattgcctctgtcactacgactaaggctaaaattcctgcgcgagtaaaa
gacattaacgaaaagggcttaagcaacgcgctttcttacgcctataagttattggataaa
ggcgtgaaacgtcgtcatatgacgccagccgctcgcgacaatttaatggcgctgatgaca
acgacgaccgaatataaaggtgttaaggatgccgatattgttgttgaagcggtatttgag
gatttagcgcttaaacatcaaatggttaaagatattgagcgtgaatgcggtgagcacacg
atttttgcgtctaacacctcatcgttacccattggtcaaattgcacaagcggcaagccgt
cctgaaaatgtgattggcttacattacttctcaccggtagaaaaaatgccgctggtggaa
gtgattgcccacgctaaaacctcaccagaaaccattgccaccacagtcgcctttgcccgt
aaacagggtaaaacgccaattgtggtacaagacggtgcggggttttatgttaaccgcatc
ctcgcgctttatatgaacgaagccgcacaattgctgctagaagggcaaagtgttgaacat
ctcgataaagcgttagtgaagtttggtttccccgttggcccaattaccttactcgatgaa
gtcggtattgatgtgggcgctaagatctctccaattcttgaaaaagagcttggtgaacgc
tttaaagcaccagcagccttcgacaagctattaagcgacgatagaaaaggtcgtaaaaat
ggcaaaggtttctatcagtatggcgctgccagcaagaaaaaagctgtggatgaaaccgtg
tatggcgtattaggtatcaagcctggtgtcgataaagaaatgagcgcggtagcggaacgc
tgtgtagtgcaaatgctgaatgaagcagtgcgctgcttagatgcaggcattattgcctcg
ccgcgcgatggtgatattggcgctatctttggcatcggcttcccaccattcttgggtgga
ccattccattatatcgatactttaggcgcggataacttagtcaaaatacttgaacgttat
caaacacaatatggcgatcgatttgagccttgccaacggcttaaggctatggcggcagaa
aaagctcgcttcttctaa

DBGET integrated database retrieval system