KEGG   Shewanella oneidensis: SO_3160Help
Entry
SO_3160           CDS       T00099                                 

Gene name
rfbc
Definition
(RefSeq) dTDP-4-keto-L-rhamnose-35-epimerase RfbC
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
son  Shewanella oneidensis
Pathway
son00521  Streptomycin biosynthesis
son00523  Polyketide sugar unit biosynthesis
son01130  Biosynthesis of antibiotics
Module
son_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:son00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    SO_3160 (rfbc)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SO_3160 (rfbc)
Enzymes [BR:son01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     SO_3160 (rfbc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-GeneID: 1170854
NCBI-ProteinID: NP_718716
UniProt: Q8ECI2
Position
complement(3297552..3298091)
Genome map
AA seq 179 aa AA seqDB search
MKCIETELAEVLIFEPKVFGDERGFFMETFRQAYFTECLLSRGFEAPALVQDNYSRSQQH
VLRGLHYQLRHPQGKLVRVCAGSIFDVAVDIRPQSATYGKWVGRILSADNHLQMWIPPGF
AHGFYVLSEYADVLYRCSDYYAPNDEYVLPWNSVQFAIDWPLLNETPILSARDANAVSA
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgaagtgcattgaaaccgagctggctgaagtacttatctttgaacctaaggtatttggc
gatgagcgtggtttttttatggaaacctttcggcaagcgtattttactgagtgcttgctg
agtcgcggatttgaagcccctgcgttagtacaagataactacagtcgctcgcagcagcat
gtgttgcgtggattgcattatcaactccggcatccgcagggcaaattggtccgcgtatgt
gccggcagtatttttgatgttgccgtcgatattcggccgcaatctgcgacctatggaaaa
tgggttggcaggattctttctgctgataaccatttacaaatgtggatcccgccaggattt
gcccatgggttttatgtgttgagtgaatacgctgatgtgctgtatcgctgcagcgattat
tatgcgccgaatgatgaatatgtgttgccttggaatagtgtgcagtttgcaattgactgg
ccgctgttaaatgaaacacccattctttccgcaagggatgcaaacgccgttagcgcctaa

DBGET integrated database retrieval system