KEGG   Shewanella oneidensis: SO_3345Help
Entry
SO_3345           CDS       T00099                                 

Gene name
yciH
Definition
translation initiation factor protein YciH
Orthology
K03113  
translation initiation factor 1
Organism
son  Shewanella oneidensis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3491375..3491704
Genome map
AA seq 109 aa AA seqDB search
MRVDPNVSLVYSTDKGRITAEPEAKAIPTSDGIVRIHRDSKGRKGKGVSVISGLGLDEAG
LKALAQTLKKQCGCGGTVKDFTIEVQTDNREQLKQLLEKQNYKVKLAGG
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atgagagtagatcccaacgtttccctagtgtacagcacagataaaggccgtattacagct
gagcctgaggcaaaagcgatccccacatccgatggcatcgtacgtatccatagagatagc
aaaggtcgtaaaggcaaaggcgtctctgtcatttcaggccttgggcttgacgaagcaggc
ttaaaagcgctagcgcaaacccttaaaaaacaatgtggttgtggcggtacagttaaggat
ttcaccatcgaagtgcaaaccgataatcgtgaacaactcaaacagctgcttgaaaaacaa
aactacaaagtcaaattggctggtggttga

DBGET integrated database retrieval system