KEGG   Shewanella oneidensis: SO_3349Help
Entry
SO_3349           CDS       T00099                                 

Definition
(RefSeq) periplasmic glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
son  Shewanella oneidensis
Pathway
son00480  Glutathione metabolism
son00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:son00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    SO_3349
  Metabolism of other amino acids
   00480 Glutathione metabolism
    SO_3349
Enzymes [BR:son01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     SO_3349
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-GeneID: 1171031
NCBI-ProteinID: NP_718903
UniProt: Q8EBZ6
Position
complement(3494173..3494706)
Genome map
AA seq 177 aa AA seqDB search
MMKFPLFILTSLMSTSVFAATCPSYLDVEVRKLHSEQSVNLCELTQGKPVLLINTASNCG
YTSQFKALEALHKEYKDKGLVVIGFPSDDFFQEENDEKDTAKVCYINYGVTFTMLATSPV
RGSDVNSVFKYLGDKAGAPKWNFYKYVVSGDGNTVMQFNSKVKPDSTELKQAIESVL
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaattcccgctatttatcttgactagcttgatgagcaccagtgtttttgcggca
acatgcccaagctatcttgatgttgaagtgcgcaaattgcactcagaacagagcgttaac
ttatgtgaactgactcagggtaagcctgtgctgctgatcaatactgcgagtaattgtggt
tatacatcacaatttaaagcgcttgaagcactccataaagaatataaagacaaaggcttg
gtggtgattggttttccttcggatgattttttccaagaggaaaacgacgaaaaagacacc
gctaaagtatgctacatcaactatggtgtcaccttcactatgctcgcgacgtctcctgtg
agggggagtgatgttaatagtgtattcaagtatttaggtgataaagccggtgcacctaaa
tggaatttctacaaatatgtggtcagtggcgatggcaacactgtgatgcaatttaattct
aaggttaaacccgatagcactgagcttaagcaggcaatagaatccgtgctgtaa

DBGET integrated database retrieval system