KEGG   Shewanella oneidensis: SO_3413Help
Entry
SO_3413           CDS       T00099                                 

Gene name
thrC
Definition
threonine synthase ThrC (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
son  Shewanella oneidensis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:son00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SO_3413 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SO_3413 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SO_3413 (thrC)
Enzymes [BR:son01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SO_3413 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3552924..3554207)
Genome map
AA seq 427 aa AA seqDB search
MELYNLKHPSQTVSFKEAVQLGLGKDRGLFFPTQIPVLHDIEALLAMPFVERSKKVLGAW
LASELGQDMVDQLVERAFNFDLPLVAVDEQRACLELFHGPTLAFKDFGARFMAQCINVFA
QDSRLTILTATSGDTGAAVADAFYGLEKVNVVVLYPKGKISELQEKMFTTLGKNIHTVAV
ASDFDACQHLVKQAFEDSDVRDGLHLNSANSINISRLLAQICYYFEAVAQSKQRHEADPV
IAVPSGNFGNLTAGLFAKAMGLPVKRFIAATNANDTVPRYLDSGHWQPNPTQATMSNAMD
VSEPSNWPRVEAICEKLGWPLADLVGICLSEAQTSEALVDLYAKGYVSEPHAAIAAKALT
LNLVPDEVGIFLGTAHPAKFKDVVDRELALNLPLPPELKAVAHKPILSAELAADFAQLKA
HLFAVLS
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggaactatataatttaaaacacccttcgcagacagtgagctttaaggaagcggtgcaa
ttaggactcggtaaagacagagggctgtttttcccaactcaaatcccggtgttgcatgat
attgaggcgcttttggcgatgccttttgtcgagcgtagcaaaaaagtacttggtgcttgg
ctcgcctctgaactgggtcaagatatggtagatcaactggttgagcgtgcctttaacttt
gatttacccttggtggcagtcgatgagcaacgtgcgtgccttgaactcttccatgggccc
accttagcatttaaggattttggggcgcgttttatggcgcaatgcatcaatgtctttgct
caagactcgcgcttaaccattttaacggcaacatcaggggatacaggggcggcagtggcc
gatgcgttttatggcctcgaaaaagtgaatgttgtggtgctctatcctaagggcaagatc
agtgaattacaggaaaaaatgttcactactttaggcaagaacatccacacagtcgcggtg
gcgtcagacttcgatgcatgccagcatttagtcaaacaggcttttgaagatagcgatgtg
cgtgatggtttgcatttaaactcggcaaactcaatcaacatcagtcgcttactggcacag
atttgttattacttcgaggcggttgcccagtcgaaacagcgtcacgaggccgaccctgta
attgcggtgcccagtggaaattttggaaatctgaccgcaggcttgtttgccaaagccatg
gggttacctgtcaaacgctttatcgccgcgaccaacgcaaatgataccgttccacgttat
ttagatagcggtcattggcaacccaatcctactcaagcgactatgtccaatgcgatggat
gtgagcgagcccagcaactggccgcgtgtcgaagctatttgtgagaaacttggttggcca
ctggcggatttagtgggtatttgcttgtcggaagcacaaacctcggaggcgttggtagat
ctttatgcgaaaggttatgtgtctgagccccatgcagcgattgcggctaaggcgttaacc
ttgaatttagtgcctgacgaagtggggatctttttaggcacagcccatcccgctaagttt
aaggatgtggttgacagggagcttgcccttaacttacctctgccgccagaattaaaagcg
gtagcgcataaaccgatattatctgctgaattagccgctgattttgcccaattaaaagcc
catttatttgcagtattaagctga

DBGET integrated database retrieval system