KEGG   Shewanella oneidensis: SO_3413Help
Entry
SO_3413           CDS       T00099                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase ThrC
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
son  Shewanella oneidensis
Pathway
son00260  Glycine, serine and threonine metabolism
son00750  Vitamin B6 metabolism
son01100  Metabolic pathways
son01110  Biosynthesis of secondary metabolites
son01120  Microbial metabolism in diverse environments
son01230  Biosynthesis of amino acids
Module
son_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:son00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SO_3413 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SO_3413 (thrC)
Enzymes [BR:son01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SO_3413 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-GeneID: 1171088
NCBI-ProteinID: NP_718966
UniProt: Q8EBT6
Position
complement(3552924..3554207)
Genome map
AA seq 427 aa AA seqDB search
MELYNLKHPSQTVSFKEAVQLGLGKDRGLFFPTQIPVLHDIEALLAMPFVERSKKVLGAW
LASELGQDMVDQLVERAFNFDLPLVAVDEQRACLELFHGPTLAFKDFGARFMAQCINVFA
QDSRLTILTATSGDTGAAVADAFYGLEKVNVVVLYPKGKISELQEKMFTTLGKNIHTVAV
ASDFDACQHLVKQAFEDSDVRDGLHLNSANSINISRLLAQICYYFEAVAQSKQRHEADPV
IAVPSGNFGNLTAGLFAKAMGLPVKRFIAATNANDTVPRYLDSGHWQPNPTQATMSNAMD
VSEPSNWPRVEAICEKLGWPLADLVGICLSEAQTSEALVDLYAKGYVSEPHAAIAAKALT
LNLVPDEVGIFLGTAHPAKFKDVVDRELALNLPLPPELKAVAHKPILSAELAADFAQLKA
HLFAVLS
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggaactatataatttaaaacacccttcgcagacagtgagctttaaggaagcggtgcaa
ttaggactcggtaaagacagagggctgtttttcccaactcaaatcccggtgttgcatgat
attgaggcgcttttggcgatgccttttgtcgagcgtagcaaaaaagtacttggtgcttgg
ctcgcctctgaactgggtcaagatatggtagatcaactggttgagcgtgcctttaacttt
gatttacccttggtggcagtcgatgagcaacgtgcgtgccttgaactcttccatgggccc
accttagcatttaaggattttggggcgcgttttatggcgcaatgcatcaatgtctttgct
caagactcgcgcttaaccattttaacggcaacatcaggggatacaggggcggcagtggcc
gatgcgttttatggcctcgaaaaagtgaatgttgtggtgctctatcctaagggcaagatc
agtgaattacaggaaaaaatgttcactactttaggcaagaacatccacacagtcgcggtg
gcgtcagacttcgatgcatgccagcatttagtcaaacaggcttttgaagatagcgatgtg
cgtgatggtttgcatttaaactcggcaaactcaatcaacatcagtcgcttactggcacag
atttgttattacttcgaggcggttgcccagtcgaaacagcgtcacgaggccgaccctgta
attgcggtgcccagtggaaattttggaaatctgaccgcaggcttgtttgccaaagccatg
gggttacctgtcaaacgctttatcgccgcgaccaacgcaaatgataccgttccacgttat
ttagatagcggtcattggcaacccaatcctactcaagcgactatgtccaatgcgatggat
gtgagcgagcccagcaactggccgcgtgtcgaagctatttgtgagaaacttggttggcca
ctggcggatttagtgggtatttgcttgtcggaagcacaaacctcggaggcgttggtagat
ctttatgcgaaaggttatgtgtctgagccccatgcagcgattgcggctaaggcgttaacc
ttgaatttagtgcctgacgaagtggggatctttttaggcacagcccatcccgctaagttt
aaggatgtggttgacagggagcttgcccttaacttacctctgccgccagaattaaaagcg
gtagcgcataaaccgatattatctgctgaattagccgctgattttgcccaattaaaagcc
catttatttgcagtattaagctga

DBGET integrated database retrieval system