KEGG   Shewanella oneidensis: SO_3434Help
Entry
SO_3434           CDS       T00099                                 

Gene name
pcm
Definition
protein-L-isoaspartate O-methyltransferase Pcm (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
son  Shewanella oneidensis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3579282..3579917)
Genome map
AA seq 211 aa AA seqDB search
MTRVALTSAVNLAKKLQDAGIRNPAVLKAISQTPRELFLDNALAHKAYENTALPIGQGQT
ISQPYIVARMTELLLQHQPQKVLEVGTGSGYQAAILAQLVPELCTVERIKALQIQARQRL
KRLDLHNVSFKYGDGWQGWLNRSPYNGIMVTAAAAKIPEALLSQLAEGGVLIIPVGEETQ
QLMRITRHSDRFSSEVIETVKFVPLVNGELA
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgactcgagttgccttaacatcggcggtgaatttagcgaaaaagcttcaggatgcgggg
atccgcaatccagccgtgcttaaggcaatatcccaaacgcctcgcgagctatttcttgat
aatgcgttagctcataaagcttatgaaaatacggcgttacccatagggcaagggcaaacg
atatctcaaccttatattgttgcacgtatgaccgagttactgctgcagcatcaaccacag
aaggtgcttgaggtggggacaggctctggctatcaagcggcgattcttgcccaattagtg
cccgaactttgcactgtagaacggataaaggcgttacagatccaagcaagacaaagatta
aaacgactcgatctgcacaatgtttcttttaagtatggtgatggttggcagggctggctg
aatcgcagtccttataatggcattatggtcacggctgcggcggcgaagattcctgaagcg
ttattatcacagttagccgaaggaggggttttgatcatccctgtgggggaagaaacccag
caattgatgcggattacgcgtcattctgaccgttttagctcggaagtgatagagactgtc
aaatttgttcccttagtcaatggcgagcttgcatag

DBGET integrated database retrieval system