KEGG   Shewanella oneidensis: SO_3509Help
Entry
SO_3509           CDS       T00099                                 

Gene name
hexB
Definition
beta-N-acetylhexosaminidase HexB (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
son  Shewanella oneidensis
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:son00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SO_3509 (hexB)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SO_3509 (hexB)
Enzymes [BR:son01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     SO_3509 (hexB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3659912..3662602)
Genome map
AA seq 896 aa AA seqDB search
MSKTIAATAILFALGLSACSQGPKTVNTPAPSSAEQPTPALLTQAQLQQFGDNLGVTYRV
LTNRPDDNCDKAAAEGRCFVAEIDFVPEVDLIGKEWAIYFSQMRPVQSVEGKEFSITHIK
GDLYRIAPTEAFSGFSKGVKKTLRFRGELWQLSETDAMPNYYIVAGDLSPVVIASTQVKQ
DPETRMEVRPYVEPFTDMVKQYSRTDADKLAPATASQLFSNNQNVSEDASLAVNTIIPTP
KTVVLHSNDKVVSLSSGIKLDVASVSSPSAEKQSFKTDQVAAALERLARLGVKESEQGLV
MKLSWRQGAEGSYLLDIKPDGIKIAAGDAAGFSYALSSLTSLIDVQDLRVNAMTIEDSPR
YPFRGMHIDVARNFHSKAMIFALIDQMAAYKLNKLHLHMADDEGWRLEIDGLPELTDIGS
KRCHDLEENTCLLPQLGSGPFAESSVNGFYSKQDYIDILKYANARQIQVIPSMDMPGHSR
AAIKSMEARYRKLLAQGKPTEAKTYLLSDAADTTVYSSVQYYNDNTLNVCMESTYQFVDK
VIDEIAKLHQAAGQPLTRYHIGADETAGAWKQSPECLSFVANNDKGVKSIEDLGAYFIER
ISNQLAEKGIEAAGWSDGMSHVRPSYMPAKVQSNIWDVIAYKGYEHANQQVNNGWDVVLS
NPEVLYFDFPYEADPKEHGYYWASRATNAHKVFSFMPDNLVANAEQWTDLQNLPFEADDR
ARTDEKGKKSGPREQGKNFAGLQGQLWSETIRSNDTVEYMIFPRLLMLAERAWHQAEWEV
PYQYQGALYNQSTGHFTAAMRDAQAQSWQQMANTLGHKEFIKLDKAGIDYRVPTVGAKIQ
GGKLFANVAYPGLKMEFRQANGQWQAYQAGQAVTAPVEIRAIAADGIRKGRSLIVN
NT seq 2691 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaacgattgccgccaccgccattttatttgcattaggcttaagtgcctgtagc
caagggcctaaaactgtaaatacgccagcgccaagctctgctgagcaacccacgccagcg
ctattaacccaagcgcaattgcagcagtttggggataatttaggcgttacctaccgggtt
ctcactaatcgacctgacgataactgtgataaggccgccgctgaggggcgctgctttgtg
gctgaaattgattttgttcctgaagtcgatctcattggcaaggaatgggcgatttatttt
agccagatgcgcccggttcaatctgttgagggtaaagagttttctatcactcatatcaag
ggcgatctctatcgcatcgcgcctaccgaggcattcagcggttttagcaaaggggttaaa
aagaccttaaggttccgtggtgagctttggcaactgtcagaaaccgatgccatgccaaac
tattacattgttgctggggatttatcgccagtggtgattgccagcactcaagtgaagcaa
gatcctgagactcgaatggaagtgcgtccctatgtcgagccgttcaccgatatggtgaaa
cagtatagccgcactgatgcggataaattggcgcctgcgaccgcatcacagctatttagc
aataaccaaaatgtcagtgaagatgccagtttagcggtgaatacgattattccaacgcca
aaaacggtggtgctccacagcaatgataaagtggtatcactctcctctggcattaaattg
gatgtcgcgtcagtgtccagtccatccgctgaaaaacagtcttttaaaaccgaccaagtt
gcagctgcgcttgaacgcttagcacgtttgggcgttaaagagtcagaacaaggcttagtg
atgaaactgagctggcgccaaggcgctgagggcagttatctgctggatattaaacctgat
ggtatcaagattgccgcaggtgatgcggcaggattttcctatgcgttatcatcgcttacc
agtttaatcgatgtgcaggatttgcgcgtaaatgcgatgacaattgaagatagcccaaga
tatccattccgcggtatgcatatcgatgtggcacgtaatttccacagtaaggcgatgatt
tttgcactgattgatcaaatggcggcttacaaactcaacaaattacatctgcatatggcc
gatgatgaaggttggcgcttagagattgatggcctgcctgagctgaccgacattggtagt
aagcgttgtcacgatcttgaggagaatacttgcttgttaccgcagcttggtagtggtcct
tttgccgagtcgagtgttaatggtttctatagtaaacaagactacatcgatattctcaaa
tacgccaatgcgcgccaaattcaagtgatcccttcgatggatatgcctggtcatagccgc
gcggcgataaaatccatggaggcgcgttaccgtaaattactcgcccaaggcaagcctacg
gaggcgaaaacctatttattgtcggatgcggctgatacgactgtgtattcttcagtgcag
tattacaacgacaacaccctgaacgtctgtatggaatcgacctatcagtttgttgataaa
gtgattgatgaaattgccaaattacaccaagccgcggggcaaccattaactcgataccat
atcggcgccgacgaaaccgcaggagcgtggaagcaatctcctgagtgtttatcctttgtg
gccaataacgataaaggagtgaaatccatcgaggatttaggcgcttactttattgagcgg
atatcgaatcaactggcagaaaaaggcattgaagccgcaggttggagtgatggcatgagc
catgttcgcccaagctatatgccagctaaagtccaatccaatatttgggatgtaattgcc
tacaaaggatatgagcatgcaaaccagcaagtgaacaacggttgggatgtagtactctcg
aatcctgaagtgctttattttgattttccctacgaagccgatcctaaagagcatggctat
tattgggccagccgcgccaccaacgcgcacaaagtgtttagctttatgccggataactta
gtggcgaatgcggagcagtggaccgacttgcaaaatctgcctttcgaggccgacgatagg
gcaagaaccgacgagaaaggcaaaaaatctggaccacgggagcaaggtaaaaactttgct
ggtttacaggggcagttgtggagtgaaaccattcgcagcaacgataccgtggagtacatg
attttccctcgtttattgatgctggctgagcgagcttggcatcaagcagagtgggaagtg
ccttaccaatatcaaggtgcattgtacaaccaaagcaccgggcactttactgcggcaatg
cgtgacgcacaggcgcaatcttggcaacaaatggccaataccttagggcataaagagttt
atcaaactcgataaggccggtattgattatcgtgttcctacggttggcgccaagatccaa
ggcggcaaactgttcgctaatgtggcgtatccagggcttaagatggagttccgccaagca
aatggccaatggcaagcttatcaagctgggcaggccgtgactgcgcccgttgagatccgt
gctattgctgctgatggtatccgcaaaggcagaagcttaatcgttaattaa

DBGET integrated database retrieval system