KEGG   Shewanella oneidensis: SO_3542Help
Entry
SO_3542           CDS       T00099                                 

Gene name
xfp
Definition
D-xylulose 5-phosphate/D-fructose 6-phosphate phosphoketolase Xfp (EC:4.1.2.9 4.1.2.22)
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
son  Shewanella oneidensis
Pathway
Pentose phosphate pathway
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:son00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SO_3542 (xfp)
Enzymes [BR:son01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     SO_3542 (xfp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3696506..3698872
Genome map
AA seq 788 aa AA seqDB search
MTNTHEINALKKYVRATNFLATSQIYLKQNVLHKRPLAHSDIKPRLLGHWGTCPGINFVY
ANINRLIVKHNRPFIYLVGPGHGFPAVQANLFIEGSLSHFYPETIPYNETGIEDICKKFS
AAYGYPSHANPEAPGQILEGGELGYSLSVGWGAVLDNPDLIATVLVGDGESETGPLAASW
YANRLVSPATNGAVLPIVHINGYKISGPTRMGRMSHEELDLEFRGLGYHPIIVDSEAEED
VYIQMATAMDTAYSMINDIQTRARKGEDIVKPRWPVILMRTAKGWTGVSEYNGQKLEGNC
ESHQVIVNKCATDKGHLAALDNWLASYRFQELYQINAQGELIFDADICSLIPPKHLACGR
QHLTYGGEVVRALSNPDLEKLSYGPEVPRGQRGYSMLKMGQWMRDAFKLNRDQRNLRIFS
PDETYSNQLQAVFEETDRAWQWPIESWDEDMSRDGRVIELLSENLLFGMLHGYTVTGRHG
MFPTYESFSQVVSSMADQYCKYVYASQGVHFRKPLPACNVVLSSLLERQDHNGYSHQNPS
FLGAMLEKHPKIISAYLPADANSTLVYTERAFADRDKLNILVAGKKELPQWLSLEEARKQ
AKDGVMVWDFASDENPDIVLAGCGDYVTQECMASLVIIRELLPRVRIRFVSVTELSSDGL
GSRKFKEKPWMMDEIFTQDKGVVFNYHGYPNTIKKLIFDYKGSRRFRIKGYEEEGSTTTP
FDMGVRNGTSRYHLVIDMAYKLFQQGVIDETKHVSITTDMLQRLVDHRNYIKAHGVDPVE
IENWVWTR
NT seq 2367 nt NT seq  +upstreamnt  +downstreamnt
atgacgaatacacatgaaataaatgctcttaaaaaatacgtaagagctactaacttcctc
gccacctcccagatttacttaaagcaaaacgtactacacaagcgcccgcttgcgcattcg
gacataaagcctcgcttgctcggtcactggggaacttgccctggtatcaactttgtctac
gccaacattaaccgacttatagtaaaacataatcgtccttttatttatttagtcggtcca
ggtcatggcttccctgcagtacaagcaaacttattcattgaaggctcactaagccacttc
tacccagaaaccattccttataatgaaactggtattgaggatatctgtaagaaattctca
gcagcttacggttatccttcgcatgctaaccctgaggctccaggacaaattcttgaaggt
ggtgaattaggttattcattatccgttggctggggggcagtgcttgataaccctgatctt
atcgcgaccgtattagtcggtgacggtgaatctgaaacaggtccattagccgcctcttgg
tacgcaaaccgtttagtttcacccgcaacgaacggtgctgtattacctatcgtccatatt
aacggctataaaatctcagggccaacgcgtatgggacgtatgagccatgaagaattagat
cttgaattccgtggccttggctatcacccaattattgtggacagcgaagccgaagaagat
gtttatatccaaatggcaaccgccatggatactgcttatagcatgatcaacgatattcaa
acccgtgcccgcaaaggtgaagatattgttaaacctcgctggccagtgattttaatgcgt
acagctaaaggctggacgggtgtaagcgaatataacgggcaaaaactcgaaggaaactgc
gaatcacaccaagttatcgtgaacaaatgtgcgactgacaaaggtcatctcgctgccctt
gataactggttagccagttatcggttccaagagctgtaccaaatcaatgcccaaggtgaa
ttgatttttgatgctgatatttgctcattgatcccaccaaaacacttagcttgtggtcgc
caacatcttacctatggtggcgaagttgtaagagcgttatctaatcctgatttagaaaaa
ctcagctacggcccagaagtgccacgtggacaacgcggttactctatgctgaagatggga
caatggatgcgtgatgcgttcaaactcaaccgtgaccagcgtaatttacgtatctttagt
ccagacgaaacctattcaaatcaacttcaggccgtatttgaagaaacggaccgagcatgg
caatggccaatcgagagctgggacgaagatatgtctcgtgatggccgtgtaatagagctg
ctatctgaaaacttgcttttcggtatgttgcacggctacacagtcacaggccgccacggc
atgttcccaacctacgagtcattctcacaggtggtttcatcaatggcagatcaatactgt
aaatatgtttatgcaagccaaggcgtgcatttccgtaaacctttgcctgcgtgtaacgtg
gttctatcttcattattagagcgtcaagatcacaatggctactcacaccaaaatccgtct
ttcttaggcgcgatgttagagaagcacccaaaaattatctctgcctatttacctgctgat
gctaacagtactttagtttacactgaacgtgcatttgcggatcgtgacaagctgaacatc
ctcgtagcaggtaaaaaagaactaccacaatggttaagcttagaagaagcacgtaaacaa
gcaaaagacggtgtcatggtgtgggattttgcttcagatgaaaatccagatatcgtcctt
gcaggttgcggtgactatgtaacacaagaatgtatggcatcattagtgatcattcgtgaa
ctgcttcctcgagtaagaattcgttttgttagcgttacagaattaagtagcgatggctta
ggcagccgtaaatttaaagaaaaaccatggatgatggatgaaatatttacccaagataaa
ggagttgtatttaactatcacggttatccaaatacaatcaaaaagttaatttttgattac
aaaggaagccgtcgtttcagaattaaaggttacgaggaagaaggttcaacgactactcca
tttgatatgggtgttcgcaacggaacttctcgctatcaccttgtgattgatatggcttac
aaactgttccaacagggcgttattgatgaaactaaacatgtttcaattacaaccgatatg
ctgcaaagactcgttgatcaccgcaactatataaaagcacatggagtagaccctgttgaa
attgaaaattgggtttggacacgctaa

DBGET integrated database retrieval system