KEGG   Shewanella oneidensis: SO_4706Help
Entry
SO_4706           CDS       T00099                                 

Definition
malate synthase domain protein
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
son  Shewanella oneidensis
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:son00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SO_4706
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SO_4706
   00630 Glyoxylate and dicarboxylate metabolism
    SO_4706
Enzymes [BR:son01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     SO_4706
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4908901..4909464
Genome map
AA seq 187 aa AA seqDB search
MNMSIIKSHQIQPNLNSFIAEEVLAVAQVNAAEHEKLAHAKQFLDRHFPLDSGSHQEVIS
YVVYYQHLLAFFADGSHSGLRQAKQFVAFNGTKDAPSAIVLQDQGCHVELCFDRTGMIGA
RDLANLEDVQIETPMELTAEPKTTRNTASRHWLSLLHAGMPSANDIQDKLFTAKDGGDYS
LQSIVNL
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgaatatgtcaattatcaagagccaccagatccaaccgaatctaaacagcttcatcgcc
gaagaagtacttgccgtcgcccaagtgaatgcggcagaacatgaaaaactcgctcatgcg
aagcaattcctcgaccgtcatttcccgctggattcgggttcacaccaagaggtgatcagc
tatgtggtttactaccaacatctgctggctttttttgccgacggtagccacagcggatta
cgtcaagccaaacagtttgtggcctttaatggcacaaaggatgcgcctagcgccatagtg
ttacaggatcaaggttgccatgtagagctatgttttgaccgcacaggtatgattggcgca
cgggatttggctaatttagaagatgtgcaaatcgaaacaccaatggaactcactgcagag
ccaaagactacacgtaacaccgcatctcgccactggttaagcctcttacatgcaggaatg
ccaagcgcaaacgatattcaagacaagctgtttaccgctaaggatggtggggactacagc
ctacaaagtatcgtaaacctctaa

DBGET integrated database retrieval system