KEGG   Shewanella oneidensis: SO_4706Help
Entry
SO_4706           CDS       T00099                                 

Definition
(RefSeq) malate synthase domain protein
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
son  Shewanella oneidensis
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:son00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SO_4706
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SO_4706
   00630 Glyoxylate and dicarboxylate metabolism
    SO_4706
Enzymes [BR:son01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     SO_4706
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4908901..4909464
Genome map
AA seq 187 aa AA seqDB search
MNMSIIKSHQIQPNLNSFIAEEVLAVAQVNAAEHEKLAHAKQFLDRHFPLDSGSHQEVIS
YVVYYQHLLAFFADGSHSGLRQAKQFVAFNGTKDAPSAIVLQDQGCHVELCFDRTGMIGA
RDLANLEDVQIETPMELTAEPKTTRNTASRHWLSLLHAGMPSANDIQDKLFTAKDGGDYS
LQSIVNL
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgaatatgtcaattatcaagagccaccagatccaaccgaatctaaacagcttcatcgcc
gaagaagtacttgccgtcgcccaagtgaatgcggcagaacatgaaaaactcgctcatgcg
aagcaattcctcgaccgtcatttcccgctggattcgggttcacaccaagaggtgatcagc
tatgtggtttactaccaacatctgctggctttttttgccgacggtagccacagcggatta
cgtcaagccaaacagtttgtggcctttaatggcacaaaggatgcgcctagcgccatagtg
ttacaggatcaaggttgccatgtagagctatgttttgaccgcacaggtatgattggcgca
cgggatttggctaatttagaagatgtgcaaatcgaaacaccaatggaactcactgcagag
ccaaagactacacgtaacaccgcatctcgccactggttaagcctcttacatgcaggaatg
ccaagcgcaaacgatattcaagacaagctgtttaccgctaaggatggtggggactacagc
ctacaaagtatcgtaaacctctaa

DBGET integrated database retrieval system