KEGG   Shewanella oneidensis: SO_4733Help
Entry
SO_4733           CDS       T00099                                 

Gene name
lypA
Definition
lysophospholipase L2 LypA (EC:3.1.1.5)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
son  Shewanella oneidensis
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:son00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4938688..4939677
Genome map
AA seq 329 aa AA seqDB search
MSQTPSVFSTEHDLNTSEQQAFWQTVVQDTLNTPDGLTLAYMMVKHPKAHASIVISSGRV
ESYLKYQELIFDLYQQGYSVFAIDHRGQGLSSRMTANPHQGHVRRFNDYIDDFALFMQTV
VLKHATSPLFLLGHSMGGAIGTLYLKQHPDVFTAAVFSAPMYGIKLPMPKGFVRWLASKL
DTSLNGGEPNYVLSGQNYKAVPVPFKGNDLTHCQSRYQAYRELYEAAPKLQLGSPTNRWL
TESLDAADACVLATTHIRTPILILQAGEDKIVDNAAQNLAVSSNCQLKVIAGAAHEIFME
KDSYRNQALNYALDFFKRYATRDVDKQAV
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgagccaaacgccatcagttttttcaacggaacacgatttaaatacctctgaacagcaa
gccttttggcaaaccgttgtccaagacacactcaacacgcccgatggattaaccttggcc
tatatgatggttaagcatcctaaagcccatgccagcatagtcatcagcagtggccgcgtg
gaatcctacctaaagtatcaagagttgatttttgacttgtatcagcaaggctactcggtg
tttgctatcgaccaccgcggtcaaggattatcgagtcgaatgaccgcaaatccccatcaa
ggacatgtacggagatttaatgactacattgatgattttgcgctgtttatgcaaacggtt
gtgcttaaacacgccacctcaccactgttcttacttgggcactctatgggcggtgccatc
ggcaccttgtatctaaaacagcatcccgatgtctttaccgctgccgtattttcagcacct
atgtatggcatcaagttacccatgcctaaagggtttgtccgttggttagccagtaaactc
gataccagtctcaacggtggagagcctaattatgtgctaagtggtcaaaactataaggca
gtcccagtcccctttaagggaaatgatctcacccattgccagagccgttaccaagcctac
cgagaattgtatgaggcggcgccaaagctgcagctaggttctccgactaaccgttggctt
actgaatccttagatgcagccgatgcttgtgtattggcaacaacgcatatacgtacacct
attctgatcctacaggccggtgaggataaaattgtcgacaatgcagcgcaaaatctcgca
gtgagctctaattgccaattaaaggtgattgcaggagcagcccatgagatatttatggag
aaagatagctatcgcaatcaagcgctgaattacgcactcgatttttttaaacgctacgca
acaagggacgtggacaaacaagctgtttaa

DBGET integrated database retrieval system