KEGG   Shewanella oneidensis: SO_4733Help
Entry
SO_4733           CDS       T00099                                 

Gene name
lypA
Definition
lysophospholipase L2 LypA (EC:3.1.1.5)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
son  Shewanella oneidensis
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:son00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    SO_4733 (lypA)
Enzymes [BR:son01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     SO_4733 (lypA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4938688..4939677
Genome map
AA seq 329 aa AA seqDB search
MSQTPSVFSTEHDLNTSEQQAFWQTVVQDTLNTPDGLTLAYMMVKHPKAHASIVISSGRV
ESYLKYQELIFDLYQQGYSVFAIDHRGQGLSSRMTANPHQGHVRRFNDYIDDFALFMQTV
VLKHATSPLFLLGHSMGGAIGTLYLKQHPDVFTAAVFSAPMYGIKLPMPKGFVRWLASKL
DTSLNGGEPNYVLSGQNYKAVPVPFKGNDLTHCQSRYQAYRELYEAAPKLQLGSPTNRWL
TESLDAADACVLATTHIRTPILILQAGEDKIVDNAAQNLAVSSNCQLKVIAGAAHEIFME
KDSYRNQALNYALDFFKRYATRDVDKQAV
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgagccaaacgccatcagttttttcaacggaacacgatttaaatacctctgaacagcaa
gccttttggcaaaccgttgtccaagacacactcaacacgcccgatggattaaccttggcc
tatatgatggttaagcatcctaaagcccatgccagcatagtcatcagcagtggccgcgtg
gaatcctacctaaagtatcaagagttgatttttgacttgtatcagcaaggctactcggtg
tttgctatcgaccaccgcggtcaaggattatcgagtcgaatgaccgcaaatccccatcaa
ggacatgtacggagatttaatgactacattgatgattttgcgctgtttatgcaaacggtt
gtgcttaaacacgccacctcaccactgttcttacttgggcactctatgggcggtgccatc
ggcaccttgtatctaaaacagcatcccgatgtctttaccgctgccgtattttcagcacct
atgtatggcatcaagttacccatgcctaaagggtttgtccgttggttagccagtaaactc
gataccagtctcaacggtggagagcctaattatgtgctaagtggtcaaaactataaggca
gtcccagtcccctttaagggaaatgatctcacccattgccagagccgttaccaagcctac
cgagaattgtatgaggcggcgccaaagctgcagctaggttctccgactaaccgttggctt
actgaatccttagatgcagccgatgcttgtgtattggcaacaacgcatatacgtacacct
attctgatcctacaggccggtgaggataaaattgtcgacaatgcagcgcaaaatctcgca
gtgagctctaattgccaattaaaggtgattgcaggagcagcccatgagatatttatggag
aaagatagctatcgcaatcaagcgctgaattacgcactcgatttttttaaacgctacgca
acaagggacgtggacaaacaagctgtttaa

DBGET integrated database retrieval system