KEGG   Shewanella oneidensis: SO_A0164Help
Entry
SO_A0164          CDS       T00099                                 

Definition
iron-containing alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
son  Shewanella oneidensis
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:son00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SO_A0164
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SO_A0164
  Lipid metabolism
   00071 Fatty acid degradation
    SO_A0164
  Amino acid metabolism
   00350 Tyrosine metabolism
    SO_A0164
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SO_A0164
   00626 Naphthalene degradation
    SO_A0164
Enzymes [BR:son01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SO_A0164
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
megaplasmid:complement(152606..153757)
Genome map
AA seq 383 aa AA seqDB search
MSTTFYMPPMSLMGQHAIKLLGTELQARNFNKALIVTDKALVDIKLVDKLTDELSAHDIA
FAIFDGVKPNPTEKNIVQGLALLEAQKCDFVISFGGGSSHDCAKGIALVAANGGHIRDYS
KGVHLSAKPQLPLVTVNTTAGTAAEMTIFAIVTNEEDETKYPIVDKNLTPIIAVNDSELM
VAMPKFLTAATGMDALTHAVEAYVSTAATPITDASAIKAIELIAQNLKAAVDNGEDREAR
EAMQYGEYLAGMAFSNASLGYVHSMAHQLGGVYDLVHGLCNAILLPVVSRFNSAEKVERF
AEVAKAMGVDTVGMTLIDAAESGILAIEKLSASVGTDQKLSDLGVKEDKLEFMAINALND
ACSLTNPRKATTEDIINIFKKAM
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgagtactacattttatatgcctccaatgtctctgatgggacaacatgctatcaaattg
ttaggcacagaactgcaggcaagaaacttcaacaaggcactgattgttacagataaggca
ttagtagatatcaagttggtggataagctgacagatgagttatctgcccacgatatcgca
ttcgcaatttttgatggcgttaagccgaacccaacagaaaaaaatattgttcagggttta
gctctgctcgaagcgcaaaaatgtgatttcgttatttcattcggcggaggttcttcacat
gactgtgctaaaggcatcgcattggtcgcagccaacggcggtcacattcgtgattactct
aaaggggttcatctgtcggctaagccacaacttcctctggtgacggtgaatactacagct
ggcactgcagcggagatgacgatatttgccatcgtgaccaatgaggaagatgaaactaaa
tacccgattgtagataaaaacctgaccccaataattgcagtaaacgactcagagctgatg
gttgcaatgcctaagttcctcacggcagcgactggtatggatgcattgactcatgcggta
gaagcttatgtgtcgacggcagcaacgccaataaccgatgcgtcagcaattaaagctatt
gaacttattgcccaaaacctgaaagcggcagtcgacaatggtgaagatcgtgaagctcgt
gaggctatgcaatacggtgagtaccttgccggtatggcattctctaatgcttcattaggt
tatgtacactcgatggctcaccaactcggtggtgtctatgacctggtgcacggtctctgt
aacgccatcttgttaccggtagtgtcacgttttaactcggctgaaaaagtggagcgtttt
gccgaggtggcgaaagcaatgggtgtagatactgtaggcatgacgttaatcgatgctgct
gaatctggcatccttgctatcgagaagctatccgcttcggttggtacagatcagaaactg
tctgaccttggtgttaaggaggacaagcttgagtttatggcaatcaacgccctgaatgat
gcctgctccttaacaaatccaagaaaggcaaccactgaagatattattaatattttcaag
aaagctatgtaa

DBGET integrated database retrieval system