KEGG   Shewanella oneidensis: SO_A0164Help
Entry
SO_A0164          CDS       T00099                                 

Definition
iron-containing alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
son  Shewanella oneidensis
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:son01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:son00010]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:son00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:son00350]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:son00625]
Metabolism; Xenobiotics biodegradation and metabolism; Naphthalene degradation [PATH:son00626]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
megaplasmid:complement(152606..153757)
Genome map
AA seq 383 aa AA seqDB search
MSTTFYMPPMSLMGQHAIKLLGTELQARNFNKALIVTDKALVDIKLVDKLTDELSAHDIA
FAIFDGVKPNPTEKNIVQGLALLEAQKCDFVISFGGGSSHDCAKGIALVAANGGHIRDYS
KGVHLSAKPQLPLVTVNTTAGTAAEMTIFAIVTNEEDETKYPIVDKNLTPIIAVNDSELM
VAMPKFLTAATGMDALTHAVEAYVSTAATPITDASAIKAIELIAQNLKAAVDNGEDREAR
EAMQYGEYLAGMAFSNASLGYVHSMAHQLGGVYDLVHGLCNAILLPVVSRFNSAEKVERF
AEVAKAMGVDTVGMTLIDAAESGILAIEKLSASVGTDQKLSDLGVKEDKLEFMAINALND
ACSLTNPRKATTEDIINIFKKAM
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgagtactacattttatatgcctccaatgtctctgatgggacaacatgctatcaaattg
ttaggcacagaactgcaggcaagaaacttcaacaaggcactgattgttacagataaggca
ttagtagatatcaagttggtggataagctgacagatgagttatctgcccacgatatcgca
ttcgcaatttttgatggcgttaagccgaacccaacagaaaaaaatattgttcagggttta
gctctgctcgaagcgcaaaaatgtgatttcgttatttcattcggcggaggttcttcacat
gactgtgctaaaggcatcgcattggtcgcagccaacggcggtcacattcgtgattactct
aaaggggttcatctgtcggctaagccacaacttcctctggtgacggtgaatactacagct
ggcactgcagcggagatgacgatatttgccatcgtgaccaatgaggaagatgaaactaaa
tacccgattgtagataaaaacctgaccccaataattgcagtaaacgactcagagctgatg
gttgcaatgcctaagttcctcacggcagcgactggtatggatgcattgactcatgcggta
gaagcttatgtgtcgacggcagcaacgccaataaccgatgcgtcagcaattaaagctatt
gaacttattgcccaaaacctgaaagcggcagtcgacaatggtgaagatcgtgaagctcgt
gaggctatgcaatacggtgagtaccttgccggtatggcattctctaatgcttcattaggt
tatgtacactcgatggctcaccaactcggtggtgtctatgacctggtgcacggtctctgt
aacgccatcttgttaccggtagtgtcacgttttaactcggctgaaaaagtggagcgtttt
gccgaggtggcgaaagcaatgggtgtagatactgtaggcatgacgttaatcgatgctgct
gaatctggcatccttgctatcgagaagctatccgcttcggttggtacagatcagaaactg
tctgaccttggtgttaaggaggacaagcttgagtttatggcaatcaacgccctgaatgat
gcctgctccttaacaaatccaagaaaggcaaccactgaagatattattaatattttcaag
aaagctatgtaa

DBGET integrated database retrieval system