KEGG   Streptococcus oralis: SOR_0054Help
Entry
SOR_0054          CDS       T01476                                 

Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
sor  Streptococcus oralis
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:sor00520]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:sor00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(54316..58347)
Genome map
AA seq 1343 aa AA seqDB search
MKLEKKQRFSIRKYAVGAASVLIGFAFSAQVVSADGITPAPTAEETVQTIQESPQAVKET
VDSKVPEKLEEKADEPVKEEVKEDQEAPRTVAPKTEESSAPVVTENAAPTPTAEKESPAP
AKTPAESTSSEKKNEAVTPAVATPSTERAAQVNEKLAKRKMISIDAGRKYFSPEQLKEII
DKAKHYGYTDLHLLVGNDGMRFMLDDMTIKANGKTYASDDVKRALENGTDAYYKDPNGNH
LTESQMTDLINYAKNKGIGLIPTVNSPGHMDAILHAMKELGIQKPNFNYFGKESARTVDL
DNKEAVAFTKALIDKYAAYFAGKTDIFNIGLDEYANDATDAKGWSVLQAYKWYPEDGFPD
KGYDKFIAYANDLARIVKSHGLKPMAFNDGIYYNSDTSFGTFDKDIIVSMWTGGWGGYDV
ASSKLLVEKGHQILNTNDAWYYVLGRNADGQGWYNLDQGLNGIKNTPITSVPKSDGATIP
FIGGMVAAWADTPSARYSPSRLFKLMRSFANANAEYFAADYESAEQALKEVPTDLNRYTA
ESVAAVKEAEKAIRSLDSNLSRAQQNTIDQAIAKLQEAVSNLTFTPEAQKEEDEKREVEK
LAKNKVISIDAGRKYFSAEQLKRIIDKASELGYSDVHLLLGNDGLRFLLDDMTITANGKT
YASDDVKNAIIEGTKAYYDDPNGTTLSQTEITELIEYAKSKGIGLIPAINSPGHMDAMLV
AMEKLGIQNPQANFDKVSKTTMDLENEEAMNFVKALIGKYMDFFAGKTKIFNYGTDEYAN
DATNAQGWYYLKWYGLYGKFAEYSNTLAAMAKERGLQPMAFNDGFYYEDKDDVEFDKDVI
ISYWSKGWWGYNLASPQYLASKGYKFLNTNGDWYYILGQKPEDGGGFLKKALENTEKTPF
NQLASTKYPEVDLPTIGSMLAIWADRPSAEYKEEEIFELMTAFADHNKDYFRANYNALRE
ELAQIPANLDGYSKESLDALNAAKEALNYNLNRNKQAELDALVAKLKAARLGLKPAATHS
GSHDENELAANVETKPELITRSEKIPFEVIKKENPNLPAGQEKIITPGVEGERTHYISVL
TENGKQTETVLDSQVTKEPVTQVVEIGAPITHKGDESGLAPAAEAKPRLDIQEEDIPFTT
VTRENPLLLKGKTQVVTKGANGRRSHYYSVSTSADGKEVKTLVDSLMTQEVVTQVIEVGT
LVTHVGDEHRLAPAAETKPRLDIQEEEIPFTTVTRENPQLPKGQTQVVTKGANGHRTAFY
SVSTTADGKEERTLVNSVVTQETVTQVVEVGTAVEKAEQTAPTTAKADEKQLPATGSQDS
AGLVAAGLMATLAAYGLTKRKED
NT seq 4032 nt NT seq  +upstreamnt  +downstreamnt
atgaaactagaaaagaaacagcgcttctccatccgaaaatacgcggttggggcagcttct
gtacttataggatttgcttttagcgcacaagtcgtatctgccgacgggattactccagct
ccaacagctgaagaaactgttcaaacgattcaggagagtccacaagcagtcaaagaaact
gtagactccaaggttccagaaaaactggaagaaaaggctgacgagcctgtgaaagaggag
gtcaaagaagaccaggaggctcctcgaacagttgctccaaaaacagaagagtcaagcgca
ccagttgtgacagaaaatgctgctccaactcctactgccgagaaagaaagccctgctcca
gctaaaactcctgccgaaagtacttcttcagaaaagaaaaatgaagccgtcacacctgca
gtagccactcctagcacggaacgagcagctcaggtaaatgaaaaactagcgaaacgaaaa
atgatctcaatcgacgctggacgcaaatacttctctccagagcaactcaaagaaatcatc
gacaaagccaaacactacggttatactgatcttcatttactagttggaaatgatggcatg
cgttttatgttggacgacatgacgatcaaagccaatggcaaaacctatgcaagcgacgat
gtcaaacgtgcactcgaaaacggaaccgatgcctactacaaggatccaaacggcaaccat
ttgacagaaagtcagatgacggacttgatcaactatgctaaaaacaaaggcattggcctc
atcccaactgtaaatagccctggtcacatggatgcgattttgcatgccatgaaagaacta
ggcatccaaaaaccgaacttcaactactttggtaaggaatctgctcgtaccgttgacctt
gataacaaagaagcggttgcatttaccaaagctctgatcgacaagtatgctgcttacttc
gctggcaaaactgacatcttcaacatcgggctagacgagtacgccaatgatgctacagac
gctaaaggctggagcgttcttcaagcctataaatggtatccagaagatggattcccagac
aagggttatgataaatttatcgcctacgccaacgaccttgctcgcatcgtcaaatctcac
ggcctcaaaccaatggcctttaacgatggtatctactataatagcgacactagctttgga
acctttgacaaagacatcatcgtttctatgtggactggtggatggggcggatacgacgtc
gcttcttctaaacttctagttgaaaaaggccaccaaatccttaataccaacgatgcttgg
tactacgtcctcggacgaaatgccgatggccaaggatggtataacctcgaccaaggactc
aatggtatcaagaacactccaatcacttctgtaccaaaatctgatggggctactatcccg
ttcatcgggggtatggtagctgcttgggcggacaccccatctgcacgctattcaccatca
cgcctcttcaaactcatgcgtagcttcgcaaatgccaatgctgaatacttcgcagctgac
tatgagtctgctgagcaagctctgaaagaagtaccaacagaccttaaccgctatactgca
gaaagtgtcgcagctgtaaaagaagctgaaaaagctattcgctcacttgatagcaacctc
agccgtgcccaacaaaacaccattgaccaagcaatcgcgaaactccaagaagctgttagc
aacctaaccttcacaccagaagctcaaaaagaagaagacgagaaacgcgaagttgaaaaa
cttgccaagaacaaggtgatctcaattgacgctggacgtaagtacttctcagctgaacaa
ctcaaacgtatcattgataaagctagtgaacttggatattctgacgtgcatctcctccta
ggaaatgatggacttcgcttcctacttgatgacatgactatcactgctaacggaaaaact
tatgcaagtgacgatgtcaaaaatgccatcattgaaggaacaaaagcttactacgatgat
ccaaacggaaccactcttagtcagactgaaatcactgaattgatcgagtacgcaaaatca
aaagggattggactcatcccagcgatcaacagcccaggtcacatggatgccatgcttgtc
gctatggaaaaattaggtatccaaaatcctcaagccaacttcgacaaggtctctaaaaca
accatggaccttgaaaacgaagaagcgatgaactttgtcaaagccctcatcggcaagtac
atggacttctttgcaggcaagactaagatcttcaactacggtacagacgaatatgccaat
gatgctaccaacgcacaaggctggtactacctcaaatggtatggactctatggcaagttt
gctgagtactctaacacccttgctgccatggccaaagaaagaggccttcaaccaatggcc
ttcaacgatggtttctactacgaggacaaggatgatgttgagtttgacaaggatgtcatc
atctcttactggtctaagggatggtggggctacaaccttgcatctccacagtaccttgca
agtaaaggctataaattccttaataccaacggagactggtactacattctcggtcaaaaa
ccagaagatggcggtggcttcctcaaaaaagctctcgaaaataccgagaaaactccattt
aatcaactagcatcaactaaataccctgaagttgaccttcctactattggtagtatgctt
gctatctgggcagatagaccaagtgctgagtacaaggaagaagaaatctttgaactcatg
actgccttcgcagatcacaacaaagactacttccgcgctaactacaatgcactccgtgag
gaacttgctcaaatccctgcaaacttggatggatacagcaaggaaagcttggatgcccta
aatgcagcgaaagaagctctcaactacaacctcaaccgtaacaaacaagccgagttagac
gctctcgtagccaagctcaaagcagcccgcctaggccttaaaccagcggcaactcactca
ggaagccacgatgaaaatgaactagctgccaacgttgaaaccaaaccggaactcatcaca
agatcagaaaagattccatttgaagttatcaagaaggaaaatccgaacctcccagccggt
caggaaaaaatcatcacaccaggtgtagagggcgaacgcactcattacatctctgttctt
actgaaaatggaaaacaaacagaaaccgttctagatagccaagtgaccaaagaacctgtg
acccaagtggttgaaatcggtgcccctattacccacaaaggggatgaaagtggtcttgct
ccagccgcagaggcaaaaccaagactggatatccaagaagaagatattccgttcactact
gtgacacgtgaaaatccactcttgctcaaagggaagactcaagtcgttactaaaggcgct
aacggtcgtcgcagtcattactactctgtgagcactagtgctgacggtaaggaagtgaaa
actcttgtagatagccttatgactcaagaagtagtgacccaagttattgaagtcggaacc
cttgtaacccatgtaggagacgaacaccgtcttgctccagccgcagaaacaaaaccaaga
ctggatatccaagaggaagaaattccattcactactgtgacacgtgaaaatcctcaatta
ccaaaaggacaaacgcaagttgttactaaaggggctaacggccaccgtactgccttctac
tctgtaagcactactgctgatggaaaagaagaaagaacgcttgtcaatagcgtggtaaca
caggaaacggtcactcaagttgttgaagtcggcactgccgttgagaaagctgagcaaact
gcaccaactactgccaaagcagatgaaaaacaactccctgcaacaggaagtcaagactct
gcaggcttggtcgcagcaggcctcatggcgactctagcagcctacggactgactaagaga
aaagaagactaa

DBGET integrated database retrieval system