KEGG   Streptococcus oralis: SOR_0056Help
Entry
SOR_0056          CDS       T01476                                 

Gene name
bgaC
Definition
beta-galactosidase 3 (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
sor  Streptococcus oralis
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:sor00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
59688..61475
Genome map
AA seq 595 aa AA seqDB search
MTRFKIEDDFYLDGKPFKILSGAIHYFRIPAEDWYHSLYNLKALGFNTVETYVAWNLHEP
VEGEFDFEGARNLERFLQIAQDLGLYAIVRPSPFICAEWEFGGLPAWLLTKDMRIRSSDP
AYIEAVARYYDQLLPRLVPRLLDNGGNILMMQVENEYGSYGEDKSYLRAIRKLMEDRGID
CPLFTSDGPWRATLKAGTLIEDDLFVTGNFGSKAPYNFSQMQEFFDEHGKKWPLMCMEFW
DGWFNRWKEPIITRDPKELAEAVREVLEQGSINLYMFHGGTNFGFMNGCSARGTLDLPQV
TSYDYDALLDEEGNPTAKYLAVKKMMATHFPEYPQLEPLYKESMEIGSIPLVEKVSLFET
LDSLSSPTESLYPKAMEELGQSYGYLLYRTEASWDAEEERLRIIDGRDRAQLFVDGQWIA
TQYQTEIGEDIYCQGNREGFSEIDILIENMGRVNYGHKFLADTQRKGIRTGVCKDLHFLL
NWKQYPLPLDNPEKIDFSKGWTEGQPAFYAFDFTIEEPKDTYLDLSEFGKGVAFVNGRHL
GRFWNVGPTLSLYIPHSYLKEGANRIIIFETEGEYKEEIHLTRKPTLKHIKGENL
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atgacaagatttaaaattgaggacgatttctatttagacggaaaaccgttcaagattttg
tccggcgccattcattattttaggattccagcagaggattggtatcattctctctataac
ttaaaggcgcttggctttaatacagtcgagacctatgtggcttggaatttacacgaacct
gttgaaggggagtttgattttgaaggtgccagaaatttggagagatttcttcaaattgca
caagatctgggtctctatgccattgtacgcccgtctccatttatctgtgcggaatgggaa
tttggtggcttgccggcttggctcttgaccaaggacatgcgaattcgctcgtccgaccct
gcatacatcgaggctgttgctcgctattatgaccaattattgccaaggcttgtgcctcgc
ttgttggataatggtggaaacattcttatgatgcaagtcgaaaatgaatatggctcttat
ggagaagataagtcttatctacgagcaattcggaaattgatggaagaccgagggattgat
tgcccactctttacttcagatggcccatggagggctactctgaaagccggaaccttgatc
gaagacgatctctttgtgacaggaaacttcggttctaaagctccgtacaacttttcacag
atgcaggaattctttgatgagcatggcaagaaatggcccctcatgtgtatggaattctgg
gatggttggttcaaccgttggaaagaacccatcatcacacgggatcctaaagaattggca
gaagctgttcgagaggtattggagcaaggctctatcaacctttacatgttccatgggggg
acaaactttggtttcatgaatggttgctcggctcgagggactctggatttgccacaagtc
acatcttacgactatgatgcccttctcgatgaagaaggaaatccaactgctaaatactta
gcagtcaagaagatgatggcaacccacttcccagagtatccacagttggaaccactctat
aaggaaagcatggagatagggtccattccattggtcgaaaaagtttccttgtttgaaact
ctggatagtctctctagtcctactgaaagcctctatccaaaagcgatggaagaacttggt
caaagttatggctaccttctctaccgcacggaggcaagttgggatgcagaagaggaacgt
ctccgtatcatcgatggacgtgaccgagctcaactctttgtagatggtcaatggattgct
actcaataccagacagagattggtgaagacatctactgtcagggcaaccgagaaggcttt
tcagaaattgacatcttgattgaaaatatggggcgtgtcaactacggtcataagttcttg
gcagatacgcagcgtaaaggaattcgaacaggtgtctgcaaggatctacatttcttactg
aattggaaacaatatccactaccactggataatcctgagaagattgatttttcaaaagga
tggacagaaggacaaccagccttttacgctttcgactttacgatcgaagagccgaaggat
acctacttagacttgtctgagtttggtaagggagttgcctttgtcaacgggcgtcatcta
gggcgtttctggaatgtcggcccgaccctctcactttatatccctcatagttatctcaag
gaaggtgctaaccgcatcattatctttgaaactgagggcgaatataaagaagagattcac
ctaactcgtaaacctacactaaaacacataaagggggaaaacttatga

DBGET integrated database retrieval system