KEGG   Streptococcus oralis: SOR_0122Help
Entry
SOR_0122          CDS       T01476                                 

Gene name
malM
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
sor  Streptococcus oralis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:sor00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
119471..120988
Genome map
AA seq 505 aa AA seqDB search
MKKRQSGVLMHISSLPGAYGIGSFGQTAYDFVDFLVRTKQRYWQILPLGTTSYGDSPYQS
FSAFAGNTHFIDLDILVEQGLLETSDLKGVDFGSDASEVDYAKIYYARRPLLEKAVKRFL
EVGDVKDFDKFAQDNQSWLELFAEYMAIKEHFDNLAWTEWPDADARARKASALESYREKL
ADKLVYHRVTQYFFFQQWLKLKAYANDNHIEIVGDMPIYVAEDSSDMWANPHLFKTDANG
KATCIAGCPPDEFSATGQLWGNPIYDWEAMDKDGYKWWVERLRESFKIYDIVRIDHFRGF
ESYWEIPAGSDTAAPGKWVKGPGYKLFAAVKEELGELNIIAEDLGFMTDEVIELRERTGF
PGMKILQFAFNPEDESIDSPHLAPANSVMYTGTHDNNTVLGWYRNEIDDPTREYMARYTN
RKEYETVPHAMLRTVFSSVSFMAIATMQDLLELDESARMNYPSTLGGNWSWRMTEDQLTP
AVEETLLDLTTIYRRINENLVELKK
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacgtcaaagtggtgtgttgatgcacatctcttctctgccaggagcatacggg
attggatcatttggccagactgcctatgatttcgttgatttcttggttcgtacgaagcaa
cgttactggcaaatcctccctctcgggacaacaagctatggagattctccataccaatca
ttctcggcctttgctggaaatacgcattttattgaccttgatatcttggtagagcaaggc
ttgctcgaaaccagtgatcttaaaggtgttgactttggtagcgatgcatctgaagttgac
tatgcgaagatttattacgcacgtcgtccacttttagaaaaagcagttaaacgcttcttg
gaagtgggtgatgtcaaagattttgataagtttgctcaagataaccaatcttggctcgaa
ctcttcgcagagtatatggctatcaaagagcattttgacaatcttgcttggacagaatgg
ccagacgcagatgctcgtgcgcgtaaagcttcagcacttgaaagctaccgtgagaaattg
gcagacaagttggtttaccaccgtgtgactcaatacttcttcttccaacaatggttgaaa
ttgaaagcctacgctaacgataaccatatcgagattgttggagatatgccaatctatgtt
gcggaagattcaagcgacatgtgggcaaatccacatctcttcaagacagatgcaaatggt
aaagcaacctgcatcgcaggatgcccaccagatgagttttctgccactggtcagctttgg
gggaacccaatctatgactgggaagcaatggacaaagacggttacaaatggtgggttgaa
cgcttgcgtgaaagcttcaaaatctacgatattgttcgtatcgaccacttccgtggcttt
gaatcttactgggaaatccctgctggttccgatacagcggcccctggtaaatgggtgaaa
ggtccaggctacaaactcttcgcagccgttaaggaagaacttggtgagctgaatatcatc
gcagaagaccttggcttcatgacagatgaggttatcgagttgcgcgaacgtactggcttc
ccagggatgaagattcttcaatttgccttcaatccagaagatgaaagtatcgatagccca
cacttggcacctgctaactctgttatgtacacaggaacacacgataacaatacggttctt
ggttggtaccgtaatgaaatcgatgatccaactcgtgagtacatggcccgctacactaac
cgtaaagagtatgaaacagtgccacacgcaatgcttcgcacagtattttcatcagtgagc
ttcatggctattgccactatgcaagatttgctagaactagatgagtcagctcgcatgaac
tacccatctactcttggaggaaactggtcttggcgtatgactgaagatcaattgacacca
gctgttgaagaaactttgcttgacttgactacaatttatcgccgaatcaatgaaaatttg
gtagaattaaagaaataa

DBGET integrated database retrieval system