KEGG   Streptococcus oralis: SOR_0132Help
Entry
SOR_0132          CDS       T01476                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sor  Streptococcus oralis
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sor00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SOR_0132 (galU)
   00052 Galactose metabolism
    SOR_0132 (galU)
   00500 Starch and sucrose metabolism
    SOR_0132 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    SOR_0132 (galU)
Enzymes [BR:sor01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SOR_0132 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(132979..133878)
Genome map
AA seq 299 aa AA seqDB search
MKQKVRKAVIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKSGIEDILVVTGK
SKRSIEDHFDSNFELEYNLKEKGKTDLLKLVDETTGMRLHFIRQTHPRGLGDAVLQAKAF
VGNEPFVVMLGDDLMDITDEKAVPLTKQLMDDYERTHASTIAVMPVPHDEVSAYGVIAPQ
GEGKDGLYSVETFVEKPAPEDAPSDLAIIGRYLLTPEIFQILENQTPGAGNEIQLTDAID
TLNKTQRVFAREFKGARYDVGDKFGFMKTSIDYALKHPQVKDDLKDYLIQLGKELAEGE
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaaaagtcagaaaagcagtcatcccagccgctggattgggaacacgcttcctc
ccagcaactaaggccttggccaaggaaatgttgccaatcgtagacaagcccactatccag
tttatcgttgaagaagccctcaagtctggaatcgaagacattttggttgttacgggtaag
tcaaaacgttctattgaggaccacttcgactcaaacttcgaattggaatataacctcaaa
gaaaaagggaaaacagatcttttgaagctggttgatgagacaactggcatgcgcctgcat
tttatccgtcaaacacatccacgtggtctcggagatgctgttttgcaagccaaggctttc
gttggaaatgaaccttttgtcgttatgcttggtgatgacttgatggatatcacagacgaa
aaggctgttccacttaccaaacaactcatggatgactacgagcgtacccacgcgtctact
atcgctgtcatgccagtccctcacgacgaagtctctgcttacggggttattgctccgcaa
ggcgaaggaaaagacggtctttacagcgttgaaaccttcgttgaaaaaccagcgccagag
gatgctcctagcgaccttgctattatcggacgctacctcctcactcctgaaattttccaa
atccttgagaaccagactccaggtgcaggaaatgaaattcagctgacagatgcaatcgat
accctcaataaaacacaacgtgtatttgctcgtgagttcaaaggggctcgttacgatgtc
ggagacaagtttggctttatgaaaacatccatcgactacgctctcaaacacccacaagtc
aaagatgacttgaaagactacctcatccaactcgggaaagagttagctgagggggaatag

DBGET integrated database retrieval system