KEGG   Streptococcus oralis: SOR_0158Help
Entry
SOR_0158          CDS       T01476                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
sor  Streptococcus oralis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sor00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SOR_0158 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SOR_0158 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SOR_0158 (thrC)
Enzymes [BR:sor01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SOR_0158 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
150870..152354
Genome map
AA seq 494 aa AA seqDB search
MTLVYQSTRDANNTVTASQAILQGLATDGGLFTPLTYPKVDLDFDTLKDASYQEVAKLVL
SAFLDDFTAEELDYCINNAYDSKFDTPAIAPLVKLDGQYNLELFHGSTIAFKDMALSILP
YLMTTAAKKHGLENKIVILTATSGDTGKAAMAGFANVPGTEIIVFYPKDGVSKVQELQMT
TQTGDNTHVIAIDGNFDDAQTNVKHMFNDVALREKLAANKLQFSSANSMNIGRLVPQIVY
YVYAYAQLIKTGEIVAGEKVNFTVPTGNFGNILAAFYAKQIGLPVGKLICASNDNNVLTD
FFKTRVYDKKREFKVTTSPSMDILVSSNLERLIFHLLGNDAVKTAELMNALSTQGQYELT
DFDTAILELFAAEYATEEETAAEIKRVYDTDAYIEDPHTAVASAVYRKYQVATGDATKTV
IASTASPYKFPVVAVEAVTGKAGLTDFEALAQLHDISGVAVPPAVDGLETAPVRHKTTVA
AADMQAAVEAYLGL
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgacattagtttatcaatcaacgcgcgatgcgaacaatacagtaacggccagccaagct
attttgcaaggtttggcgacggatggtggtctgtttacacctcttacttatccaaaggtg
gatttggactttgacacattaaaagatgcttcttaccaagaagtggctaaattagttttg
tcagcatttttagatgactttacagctgaggagttggattactgtatcaacaatgcctac
gatagcaagtttgatactccagcgattgcgccattggtgaaactggatgggcaatataat
ttggaattgttccatggttcaacgattgcctttaaagatatggccttgtctatcttgcct
taccttatgacgactgctgctaaaaagcatggtttggagaacaaaatcgtcattttgaca
gcgacatctggtgatactgggaaagcggctatggcagggtttgcgaatgtgcctgggact
gagatcatcgtcttttatccaaaagacggtgtcagcaaggtacaagagttgcaaatgact
actcagactggcgacaatactcatgttatcgctattgatggaaactttgatgatgcgcaa
accaacgtcaaacatatgtttaacgatgtagctcttcgtgaaaagttggctgccaataaa
cttcaattttcatcagctaactctatgaatattggtcgtttggtaccacagattgtttat
tatgtctatgcctacgctcagttgattaagactggtgagattgtggctggtgaaaaggtc
aattttacagtaccaacaggaaactttggaaatatcttggctgccttttatgctaaacaa
atcggtctgccagttggcaaattaatctgtgcttcaaatgacaataatgttttaactgac
ttctttaaaacacgtgtttacgacaagaaacgtgagttcaaggtaacgactagtccatct
atggatatcttggtatcttcaaacttggagcgtttgattttccatcttttggggaatgat
gcggttaagacagctgaactcatgaatgccttgagtacacaaggacaatatgaattgaca
gactttgatacagcgattctggaactctttgcagctgaatatgcgactgaggaagaaact
gcggcagaaattaaacgtgtttatgatacagatgcctatatcgaggatccacatacggcg
gttgcctcagctgtttatagaaaataccaagtggctactggcgatgcgactaagacagtg
attgcttcaacagctagtccttacaagttcccagtggttgccgtagaagcggtaacagga
aaagcaggcttgactgactttgaagccttggctcaattacatgacatttcaggagtggca
gtgccaccagcggttgatggccttgaaacagctccagttcgtcataaaacaacagtggca
gctgctgacatgcaagcagcggttgaggcttatctaggactttaa

DBGET integrated database retrieval system