KEGG   Streptococcus oralis: SOR_0187Help
Entry
SOR_0187          CDS       T01476                                 

Gene name
adhE
Definition
(GenBank) bifunctional acetaldehyde-CoA/alcohol dehydrogenase
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
sor  Streptococcus oralis
Pathway
sor00010  Glycolysis / Gluconeogenesis
sor00071  Fatty acid degradation
sor00620  Pyruvate metabolism
sor00625  Chloroalkane and chloroalkene degradation
sor00626  Naphthalene degradation
sor00650  Butanoate metabolism
sor01100  Metabolic pathways
sor01110  Biosynthesis of secondary metabolites
sor01120  Microbial metabolism in diverse environments
sor01130  Biosynthesis of antibiotics
sor01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sor00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SOR_0187 (adhE)
   00620 Pyruvate metabolism
    SOR_0187 (adhE)
   00650 Butanoate metabolism
    SOR_0187 (adhE)
  Lipid metabolism
   00071 Fatty acid degradation
    SOR_0187 (adhE)
  Amino acid metabolism
   00350 Tyrosine metabolism
    SOR_0187 (adhE)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SOR_0187 (adhE)
   00626 Naphthalene degradation
    SOR_0187 (adhE)
Enzymes [BR:sor01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SOR_0187 (adhE)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     SOR_0187 (adhE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: CBY99888
UniProt: F2QGM7
Position
175994..178645
Genome map
AA seq 883 aa AA seqDB search
MADKKTVTPEEKQLAAEKHVDGLVKKALVALDEMRKLNQEQVDYIVAKASVAALDAHGIL
AQHAVEETGRGVFEDKATKNLFACEHVVNNMRGVKTVGVIEDDPITGLTKIAEPVGVICG
VTPTTNPTSTAIFKSLIALKTRNPIVFAFHPSAQESSAHAAQIVRDAAIAAGAPENCVQW
ITKPSMEATGALMNHEGVATILATGGNAMVKAAYSCGKPALGVGAGNVPAYVEKSADLRQ
AAHDIVMSKSFDNGMVCASEQAVIIDKEVYDEFVEEFKSYHTYFVNKKEKALLEEFCFGV
KANSKNCAGAKLNANIVGKPAAWIAEQAGFSVPEGTNILAAECAEVGPKEPLTREKLSPV
IAVLKAEDTEDGLTKARQMVEFNGLGHSAAIHTKDEELAKRFGTEIKAMRIIWNSPSTFG
GIGDVYNAFIPSLTLGCGSYGRNSVGDNVSAINLLNIKKVGKRRNNMQWFKVPSKIYFER
NSIQYLQTCEDIERVLIVTDKSIEKLGFVQRVIDQLNARSNRVTIQVFSDVEPDPDITTV
ERGAEVMKAFEPDTIIALGGGSPMDAAKVMWLFYEQPEIDFRDLVQKFMDIRKRAFRFPS
LGKKAKYIGIPTTSGTGSEVTPFAVISDKKNNRKYPLADYSLTPTIAIVDPALVESVPDF
IAADTGMDVLTHATEAYTSNFANDYTDGIALQTIKLVFEWLEKSVKTADPEAREKMHNAS
TMAGMAFANAFLGMSHSMAHKIGGVHHTVHGRTNAILLPYVIRYNGTRPSKTTTWPKYNY
WKADEKFQDIAKMLGLPHSTPEEAVEAYAKAVYELGVAVGIKMNFKDQGIDEKAWKDSLH
EIALLAYEDQCSPANPRLPMVADMEEIMADAYYGYAERPGRRK
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atggctgataaaaaaacagtaacaccagaggaaaaacaacttgctgctgaaaagcatgtc
gatggtctcgtgaaaaaagccttggttgcgcttgatgaaatgcgcaagctgaaccaagag
caagttgactacatcgtggcaaaagcttcggttgcagcacttgacgcgcacggtatcctt
gcgcaacatgcagttgaagaaactggtcgtggggtatttgaagacaaggcgacaaaaaac
ctatttgcctgcgaacacgtagtgaacaatatgcgtggagttaaaacagttggagttatt
gaagatgatccaattacaggtttgacaaagattgcggaacctgtaggggtaatctgtggt
gtcactccgacaacaaacccaacttcaacagcgattttcaaatcactcattgctttgaaa
acacgtaacccaatcgtttttgccttccacccatctgctcaagaatcatcagctcacgca
gcacaaatcgttcgcgatgcagcgattgcagctggcgcacctgagaactgtgtgcaatgg
attacaaagccatctatggaagcaactggagcgctaatgaaccacgaaggtgttgcaact
attcttgcaactggtgggaatgccatggttaaagctgcatactcatgtggaaaaccagct
cttggggtaggtgccggaaacgttcctgcctatgtagaaaaatctgctgaccttcgtcaa
gctgctcatgacatcgttatgtctaaatcatttgataatgggatggtctgtgcatcagaa
caagccgttatcattgataaagaagtgtatgacgaatttgtagaagaattcaaatcatat
cacacttactttgtaaacaaaaaagaaaaagcccttcttgaagaattctgtttcggtgtg
aaagctaacagcaaaaattgtgcaggtgctaaactaaatgcaaacatcgttggtaaacca
gcagcatggattgctgaacaagcaggattcagcgttccagaaggaacaaatatcttggct
gcagaatgtgcagaagtaggaccaaaagaaccattgactcgtgagaaattgtcaccagtt
attgctgtcctaaaagctgaagacacagaagatggtcttacaaaagctcgtcaaatggtt
gagtttaacggacttggtcactcagcagctatccatacaaaagacgaagagcttgctaaa
cgctttggtacagaaatcaaagctatgcgtattatctggaactctccatctactttcggt
ggtattggtgacgtttacaatgccttcatcccatcattaacacttggatgtggttcatac
ggacgcaactcagttggtgataacgtgagcgctattaaccttctaaacatcaagaaagta
gggaaacgtagaaataatatgcaatggtttaaagttccttcaaaaatttacttcgaacgc
aactctatccaataccttcaaacatgtgaagatattgagcgcgttctgattgttacagac
aaatctatcgaaaaacttggctttgttcaacgtgttattgatcaattgaacgcacgtagc
aaccgtgtaactattcaagtcttctcagatgttgaaccagatccagacatcacaactgta
gaacgtggtgctgaagtgatgaaagcatttgaaccagatacaattatcgctcttggtggt
ggttctccaatggacgctgcgaaagtgatgtggctcttctacgaacaaccagaaatcgac
ttccgtgacttggttcaaaaattcatggatatccgtaaacgtgccttccgcttcccatca
cttggtaagaaagcgaagtacatcggtatcccaacaacttcaggtacaggttcagaagta
acaccatttgccgttatctctgacaagaaaaacaaccgcaaatatccattggctgactac
tcattgacaccaactattgccattgttgaccctgctttggttgaatcagttccagacttc
atcgctgctgatacaggtatggacgtcttgactcacgcgactgaagcctacacttcaaac
ttcgcgaacgactacacagacggtattgcgcttcaaacaatcaaacttgtctttgaatgg
ttggaaaaatcagttaagacagctgacccagaagctcgtgagaaaatgcacaatgcgtct
acaatggctggtatggccttcgccaatgccttccttggtatgagccactcaatggcccac
aagatcggtggtgttcaccacactgttcacggacgtacaaacgcaatcttgcttccatac
gttatccgttacaacggaactcgtccatctaagacgactacatggcctaaatacaactac
tggaaagctgatgagaaattccaagacatcgcgaaaatgcttggcttgcctcactcaact
ccagaagaagcagttgaagcatacgctaaagctgtttacgaacttggtgttgcagtaggt
atcaagatgaacttcaaggatcaaggaattgatgaaaaagcttggaaagacagcttgcat
gaaattgccttgcttgcttatgaagatcaatgttcacctgctaacccacgcttgccaatg
gtagctgacatggaagaaatcatggcagatgcttactatggttatgcagaacgaccagga
cgtcgtaaataa

DBGET integrated database retrieval system