KEGG   Streptococcus oralis: SOR_0228Help
Entry
SOR_0228          CDS       T01476                                 

Gene name
sulC
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
sor  Streptococcus oralis
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:sor00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
215206..215760
Genome map
AA seq 184 aa AA seqDB search
MDTQKIETAVKMIIEAVGEDANREGLQETPARVARMYQEIFSGLGQTAEEHLSKSFEIID
DNMVVEKDIFFHTMCEHHFLPFYGRAHIAYIPDGRVAGLSKLARTVEVYSKKPQIQERLN
IEVADALMDYLGAKGAFVVIEAEHMCMSMRGVRKPGTATLTTVARGLFKTDKDLRDQAYR
LMGL
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atggatacacaaaagattgaaacggctgtaaaaatgattattgaggctgttggcgaggat
gctaaccgagagggcttgcaggaaacacctgctcgtgtagcccgtatgtaccaagagatt
ttttcaggtcttggccaaactgctgaggaacatttatcaaaatcctttgagattattgat
gataatatggtggtagaaaaggatatttttttccacactatgtgtgaacaccacttcttg
cccttttacgggagagcccacattgcctacattccagatggtcgtgtggcaggcctgtct
aagctagcccgtacggttgaagtttattctaaaaaaccacagattcaagaacggttgaat
atcgaagtggccgatgccttgatggactatctgggggctaaaggagcctttgttgtcatt
gaggcggaacatatgtgtatgagcatgcgtggtgtcagaaaaccaggtactgcaaccttg
acgacagtagctcgcggtctatttaaaacagataaggacctccgagatcaggcttatcgt
ctaatgggactataa

DBGET integrated database retrieval system