KEGG   Streptococcus oralis: SOR_0437Help
Entry
SOR_0437          CDS       T01476                                 

Definition
sucrose phosphorylase (EC:2.4.1.7)
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
sor  Streptococcus oralis
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:sor00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SOR_0437
Enzymes [BR:sor01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     SOR_0437
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
416762..418204
Genome map
AA seq 480 aa AA seqDB search
MTIQNKTMLITYSDSLGNNLKDLYENLEEHFGDAIGGVHLLPFFPSTGDRGFAPVDYDEV
DSVFGDWEDVKHLGEKYYLMFDFMINHISRQSKYYRDYQEKHEASEFKDLFLNWDKFWPE
NRPTQSDVDLIYKRKDRAPKQEIVFADGSVEHLWNTFGEEQIDLDVTKEVTMRFIRKTIQ
HLASNGCDLIRLDAFAYAVKKLDTNDFFVEPDIWNLLDRVRDIAAEYGTELLPEIHEHYS
IQFKIADHDYYVYDFALPMVTLYTLYSSRTERLAKWLKMSPMKQFTTLDTHDGIGVVDVK
DILTDEEIDYASNELYKVGANVKRKYSSAEYNNLDIYQINSTYYSALGDDDVKYFLARLI
QAFAPGIPQVYYVGLLAGKNDLKLLEETKEGRNINRHYYSNEEIAEEVQRPVVKSLLNLF
SFRNQSEAFDLEGTIEIETPTAHSIVIKRQNKDKSVTAVAEIDLQSQTYQVVENGRKIQF
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgaccattcaaaataaaactatgttgattacttactcagatagtcttggaaataacctt
aaagacctgtatgagaatttggaagagcattttggtgatgctattggaggagttcacctt
ctaccatttttcccatcaacaggtgatcgtggatttgcgccagttgactatgatgaagtg
gattcagtttttggtgattgggaggacgttaagcatttaggtgagaaatattatcttatg
tttgactttatgattaatcatatttctcgtcaatctaagtattatagggactatcaagaa
aaacatgaagccagtgaatttaaggatctctttttaaactgggataagttttggccagag
aaccgtccgacacagtctgacgtagatttaatctacaagcgtaaggatcgtgcaccaaag
caagagattgtttttgcagatggttcagtggaacatttgtggaatacctttggtgaggag
cagattgatcttgatgtgaccaaagaagtaacgatgagattcatccgtaagacgattcaa
catctagcaagtaacgggtgtgatttgattcgtctagatgcctttgcttatgcagtgaag
aaattggataccaatgatttctttgtggaaccagatatttggaatttattggacagagtt
cgagatatcgctgctgagtatgggacagagctcttacctgagattcatgaacactattcg
attcagtttaaaatagcagatcatgattactatgtttacgattttgcccttccaatggtg
accctttatactctttacagttctagaacagagcgtttggcaaagtggttaaagatgagc
ccgatgaagcaatttacgacactagatactcatgacgggattggagtggtggatgtcaaa
gatatcctgactgatgaggaaattgactatgcttcaaatgagctctataaggttggagcg
aatgtcaaacgtaagtactctagtgcagagtataacaatctagatatctaccaaatcaat
tcaacctactattctgcgcttggagatgatgatgtcaagtatttcctcgctcgtttgatt
caagcttttgctccaggcattcctcaggtttactatgtgggtctattagcaggaaaaaat
gacttgaaattgttagaagaaaccaaagaaggtcgaaatattaatcgccattactatagc
aatgaggaaatagcagaagaagttcaacgtcctgtggtgaagtctcttctcaatctattt
tctttccgtaatcaatcagaggcctttgacctagaagggactattgagatagaaacacca
acagctcacagcattgtaatcaaacgtcaaaataaagataagtccgtaacagcagtagca
gaaattgatttgcaaagtcagacctatcaagtagtggaaaacggcagaaaaattcagttc
taa

DBGET integrated database retrieval system