KEGG   Streptococcus oralis: SOR_0471Help
Entry
SOR_0471          CDS       T01476                                 

Gene name
trpEby
Definition
(GenBank) tryptophan synthase subunit beta
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
sor  Streptococcus oralis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sor00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SOR_0471 (trpEby)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SOR_0471 (trpEby)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SOR_0471 (trpEby)
Enzymes [BR:sor01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SOR_0471 (trpEby)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
446052..446843
Genome map
AA seq 263 aa AA seqDB search
MSIWGAEDVERQRLNVFRMEMMGATVHAVETGTRTLKDAVDAAFGAWMNDLEAFYVLGSA
VGPHPYPTIVHEFQKVISEESRRQILEKEGRLPDYVIACVGGGSNAIGAFSQYVADEEVK
LVGVEAAGHGLDTDKHAATMTKGSVGIVDGMKTYAVFKEDGELAPVYSISAGLDYPGVGP
EHAYFKDSGRVEYVAATDEEAVQALLLLSKTEGIIPAIESSHAIAEAVKRAPKLSKDEII
IINVSGRGDKDVAAIADYLEAKK
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgtctatatggggggcagaggatgttgagcgtcaacgtctcaatgttttccgtatggag
atgatgggagcaactgttcacgcagttgaaacgggaacgcgaactctcaaggatgcggtt
gatgcagcctttggagcatggatgaatgaccttgaagcattctacgttttgggatctgct
gtaggacctcatccttatcctacaattgttcatgaattccaaaaggtcatcagtgaggaa
tctcgtcgtcaaatcttagaaaaagaaggccgtttaccagactacgtcattgcctgtgta
ggtggtggttccaatgctatcggtgctttttcacagtatgtggctgatgaagaagtcaaa
ttggttggggtcgaagctgccggtcacggacttgacacagacaagcatgcagccactatg
acaaaaggtagtgtcggaattgtcgatggtatgaagacctatgcagtctttaaggaagac
ggagagctagcgccagtttactctatctcagctggtttggactatccaggggttggccca
gaacatgcctactttaaagattcaggtcgcgtggaatatgtggcagcgacagatgaagaa
gctgttcaagccttgctccttctcagcaagactgaagggattatcccagcgattgaaagt
tcgcacgccatcgcagaagcggttaaacgtgcgccgaaactaagtaaagatgagattatc
atcatcaatgtctctggtcgtggagacaaagacgtagctgcgattgcagactacctagaa
gctaaaaaataa

DBGET integrated database retrieval system