KEGG   Streptococcus oralis: SOR_0478Help
Entry
SOR_0478          CDS       T01476                                 

Gene name
trpEb
Definition
(GenBank) tryptophan synthase, beta subunit (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
sor  Streptococcus oralis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sor00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SOR_0478 (trpEb)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SOR_0478 (trpEb)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SOR_0478 (trpEb)
Enzymes [BR:sor01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SOR_0478 (trpEb)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
451404..452627
Genome map
AA seq 407 aa AA seqDB search
MAYQEPNKDGFYGKFGGRFVPETLMTAVLELEKAYRESQADPSFQEELNQLLRQYVGRET
PLYYAKNLTQHIGGAKIYLKREDLNHTGAHKINNALGQVLLAKRMGKKKIIAETGAGQHG
VATATAAALFNMECTIYMGEEDVKRQALNVFRMELLGAKVEAVTDGSRVLKDAVNAALRS
WVANIDDTHYILGSALGPHPFPEIVRDFQSVIGREAKQQYRDLTGQDLPDALVACVGGGS
NAIGLFHPFVEDESVAMYGAEAAGLGVDTEHHAATLTKGRPGVLHGSLMDVLQDAHGQIL
EAFSISAGLDYPGIGPEHSHYHDIKRASYVPVTDEEALEGFQLLSRVEGIIPALESSHAI
AFAVKLAKELGPDKSMVVCLSGRGDKDVVQVKDRLEADAAKKGEAHA
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggcatatcaagaaccaaataaagatggattttacggaaaattcggcggacgtttcgtc
ccagaaacattgatgacagcagttttggagttggaaaaagcttatcgtgaaagtcaggca
gacccaagcttccaagaggaattgaaccaacttttgcgccagtacgtaggacgtgaaact
cccctttactacgcaaaaaacttgacccagcatatcggcggagccaagatttatctcaaa
cgggaagaccttaaccatacaggtgctcacaagattaacaatgccttgggacaagttctt
ctggctaaacgaatgggcaaaaagaaaattatcgctgaaacaggtgctggtcagcacggt
gtggcaactgcaacagctgcggccctctttaacatggaatgtaccatctacatgggtgag
gaagatgttaaacgccaagcccttaatgtcttccgtatggagcttttaggagctaaggtt
gaggctgtgacagatggttcgcgcgtgcttaaggatgcggtcaatgcagcccttcgttct
tgggtagcgaatatcgacgatacccactatatccttggttctgccttggggcctcatcct
ttcccagaaatcgttcgtgacttccaaagtgttatcggacgcgaagctaaacaacagtac
cgtgacttgacaggtcaagatttgccagatgccctagtagcttgtgttggtggtggttcg
aatgctatcggtctcttccatccatttgtagaagacgagtcagtggctatgtatggagct
gaagcagcaggacttggtgtggatacggagcaccacgcagctaccttgaccaagggtcgt
ccgggtgtccttcacggttctctcatggatgtactccaagatgcccatggtcaaattctt
gaagccttctctatctcagcaggtttggactatcctggtatcggtccagaacattctcac
taccacgatatcaaacgtgccagctatgttcctgtgacggacgaggaagccttggaagga
ttccaactcttgtctcgtgtggaaggaattatcccagccttggaatctagccacgccatc
gcttttgcagtgaaattggccaaagaacttggtccagacaagtcaatggttgtctgccta
tccggtcgtggggacaaggatgtagttcaagtcaaagaccgcttggaagcagatgcagca
aagaagggagaagcccatgcctaa

DBGET integrated database retrieval system