KEGG   Streptococcus oralis: SOR_0479Help
Entry
SOR_0479          CDS       T01476                                 

Gene name
trpEa
Definition
(GenBank) tryptophan synthase subunit alpha (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
sor  Streptococcus oralis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sor00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SOR_0479 (trpEa)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SOR_0479 (trpEa)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SOR_0479 (trpEa)
Enzymes [BR:sor01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SOR_0479 (trpEa)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
452620..453396
Genome map
AA seq 258 aa AA seqDB search
MPKTLTEKLNAIKATGKGIFVPYIMAGDHEKGLDGLGETIHFLEDLGVSAIEVGIPFSDP
VADGPVIEEAGLRSLAHETSTQALVETLKTIQTEVPLVIMTYFNPIFQYGVDKFVNDLAD
TAVKGLIIPDLPHEHANFVEPFLVDTDIALIPLVSLTTGLERQKELIKGAEGFVYAVAVN
GVTGKSGNYRADLDKHLAQLHQVADIPVLTGFGVSSQADVERFNAVSDGVIVGSKIVKAL
HQGEPIEDFIKQAVDYQK
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgcctaagacactaacagaaaaattgaacgctataaaagcgactggaaagggaattttc
gttccttatatcatggctggagaccacgagaaaggtttggatggtctcggtgaaacaatc
cactttttagaagatttgggtgtttcagccattgaagtgggtattcccttttcagaccct
gttgcagatggccctgttatcgaagaagctggcttgcgcagtctagctcacgaaacttct
acccaggctttggttgaaaccttgaaaaccattcagactgaagtgccactggtcatcatg
acctacttcaaccccatctttcagtacggtgtggacaaatttgtcaatgatctggcagat
acagcagttaagggcttgattatcccggatctgcctcatgagcatgccaactttgtagag
ccatttttggtagacacagatatcgccttgattcccctagttagtttgaccacaggactt
gagcgccaaaaagagttgatcaagggagctgaaggattcgtctatgccgttgctgtcaat
ggggtgacagggaaatcaggaaattaccgtgcagacttggacaagcacttggcgcaattg
catcaagtagctgacatcccagtcttgacaggttttggtgtgtctagtcaggctgatgta
gaacgcttcaatgcggtgtcagatggcgttatcgtcggttcgaaaattgtaaaagctctc
caccaaggagagccgattgaggactttatcaaacaagcagtagattaccaaaaataa

DBGET integrated database retrieval system