KEGG   Streptococcus oralis: SOR_0591Help
Entry
SOR_0591          CDS       T01476                                 

Definition
(RefSeq) 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
sor  Streptococcus oralis
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:sor00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SOR_0591
   01230 Biosynthesis of amino acids
    SOR_0591
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SOR_0591
  Energy metabolism
   00680 Methane metabolism
    SOR_0591
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SOR_0591
Enzymes [BR:sor01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SOR_0591
Exosome [BR:sor04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SOR_0591
  Exosomal proteins of melanoma cells
   SOR_0591
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
557491..558183
Genome map
AA seq 230 aa AA seqDB search
MVKLVFARHGESEWNKANLFTGWADVDLSEKGTQQAIDAGKLIKEAGIEFDQAYTSVLKR
AIKTTNLALEASDQLWVPVEKSWRLNERHYGGLTGKNKAEAAEQFGDEQVHIWRRSYDVL
PPNMDRDDEHSAHTDRRYASLDDSVIPDAENLKVTLERALPFWEDKIAPALKDGKNVFVG
AHGNSIRALVKHIKRLSDDEIMDVEIPNFPPLVFEFDEKLNVVSEYYLGK
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaattggtttttgctcgccacggtgagtctgaatggaacaaagctaaccttttc
actggttgggctgatgttgatttgtctgaaaaaggaacacaacaagcgattgacgctggt
aaattgatcaaagaagctggtatcgaatttgaccaagcttacacttcagtattgaaacgt
gcgatcaaaacaacaaacttggctcttgaagcttctgaccaattgtgggttccagttgaa
aaatcatggcgcttgaacgaacgtcactacggtggtttgactggtaaaaacaaggctgaa
gctgctgaacaatttggtgatgagcaagttcacatctggcgtcgttcatacgatgtattg
cctccaaacatggaccgtgacgatgagcactcagctcacactgaccgtcgttacgcttca
cttgatgactcagttatcccagatgctgaaaacttgaaagtgactttggaacgtgccctt
ccattctgggaagacaaaatcgctccagcacttaaagatggtaaaaacgtattcgtagga
gctcacggtaactcaatccgtgcccttgtaaaacacatcaaacgcttgtcagacgacgaa
atcatggacgtggaaatccctaacttcccaccattggtattcgaatttgacgaaaaattg
aacgtagtttctgaatactaccttggaaaataa

DBGET integrated database retrieval system