KEGG   Streptococcus oralis: SOR_0591Help
Entry
SOR_0591          CDS       T01476                                 

Definition
(GenBank) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase (Phosphoglyceromutase)
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
sor  Streptococcus oralis
Pathway
sor00010  Glycolysis / Gluconeogenesis
sor00260  Glycine, serine and threonine metabolism
sor00680  Methane metabolism
sor01100  Metabolic pathways
sor01110  Biosynthesis of secondary metabolites
sor01120  Microbial metabolism in diverse environments
sor01130  Biosynthesis of antibiotics
sor01200  Carbon metabolism
sor01230  Biosynthesis of amino acids
Module
sor_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sor_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:sor00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SOR_0591
  Energy metabolism
   00680 Methane metabolism
    SOR_0591
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SOR_0591
Enzymes [BR:sor01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SOR_0591
Membrane trafficking [BR:sor04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    SOR_0591
Exosome [BR:sor04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SOR_0591
  Exosomal proteins of melanoma cells
   SOR_0591
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: CBZ00253
UniProt: F2QC85
Position
557491..558183
Genome map
AA seq 230 aa AA seqDB search
MVKLVFARHGESEWNKANLFTGWADVDLSEKGTQQAIDAGKLIKEAGIEFDQAYTSVLKR
AIKTTNLALEASDQLWVPVEKSWRLNERHYGGLTGKNKAEAAEQFGDEQVHIWRRSYDVL
PPNMDRDDEHSAHTDRRYASLDDSVIPDAENLKVTLERALPFWEDKIAPALKDGKNVFVG
AHGNSIRALVKHIKRLSDDEIMDVEIPNFPPLVFEFDEKLNVVSEYYLGK
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaattggtttttgctcgccacggtgagtctgaatggaacaaagctaaccttttc
actggttgggctgatgttgatttgtctgaaaaaggaacacaacaagcgattgacgctggt
aaattgatcaaagaagctggtatcgaatttgaccaagcttacacttcagtattgaaacgt
gcgatcaaaacaacaaacttggctcttgaagcttctgaccaattgtgggttccagttgaa
aaatcatggcgcttgaacgaacgtcactacggtggtttgactggtaaaaacaaggctgaa
gctgctgaacaatttggtgatgagcaagttcacatctggcgtcgttcatacgatgtattg
cctccaaacatggaccgtgacgatgagcactcagctcacactgaccgtcgttacgcttca
cttgatgactcagttatcccagatgctgaaaacttgaaagtgactttggaacgtgccctt
ccattctgggaagacaaaatcgctccagcacttaaagatggtaaaaacgtattcgtagga
gctcacggtaactcaatccgtgcccttgtaaaacacatcaaacgcttgtcagacgacgaa
atcatggacgtggaaatccctaacttcccaccattggtattcgaatttgacgaaaaattg
aacgtagtttctgaatactaccttggaaaataa

DBGET integrated database retrieval system