KEGG   Streptococcus oralis: SOR_0610Help
Entry
SOR_0610          CDS       T01476                                 

Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
sor  Streptococcus oralis
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sor00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SOR_0610
   00670 One carbon pool by folate
    SOR_0610
Enzymes [BR:sor01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     SOR_0610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
578031..578537
Genome map
AA seq 168 aa AA seqDB search
MTKKIIAIWAQDEKGVIGKEDRLPWHLPAELQHFKETTLNHAILMGRVTFDGMGRRLLPK
RQTLILTRNSEEVIDGALVFQDVESVLAWYQSQEKNLYILGGKQIFQAFEPYLDEIIVTQ
IHAQVEGDTYFPEEFDLSRFETVASKSYTRDEKNDYDFTIEYRDRKEV
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagaaaatcatagccatttgggcccaagatgaaaaaggtgtgattgggaaggaa
gatcgtctcccttggcatttgccagcagagttgcaacattttaaggaaacaactttaaat
catgctatactgatggggcgagtgacctttgatggcatgggacgtcgtctgcttccaaaa
cggcaaaccctgattttaacgcgcaatagcgaagaagtcatagatggggcgctcgtattt
caagatgtggagtctgttttagcgtggtatcagagtcaggaaaaaaatctctatatcctt
ggcggaaaacagatttttcaggcttttgagccctatttagatgaaatcatcgtgacacag
attcatgctcaggtggagggagatacctatttccctgaggagtttgacttgtctcgtttt
gagacagtagcaagcaaatcttacacccgagatgagaaaaacgactatgattttactatc
gaataccgagatagaaaggaagtctaa

DBGET integrated database retrieval system