KEGG   Streptococcus oralis: SOR_0689Help
Entry
SOR_0689          CDS       T01476                                 

Gene name
glk
Definition
glucose kinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
sor  Streptococcus oralis
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sor00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SOR_0689 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SOR_0689 (glk)
   00052 Galactose metabolism
    SOR_0689 (glk)
   00500 Starch and sucrose metabolism
    SOR_0689 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    SOR_0689 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SOR_0689 (glk)
   00524 Butirosin and neomycin biosynthesis
    SOR_0689 (glk)
Enzymes [BR:sor01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SOR_0689 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
658056..659015
Genome map
AA seq 319 aa AA seqDB search
MSQKIIGIDLGGTSIKFAILTQEGEIQEKWSIKTNILDEGSHIVDDMIESIQHRLDLLGL
SATDFRGIGMGSPGVVDREKGTVIGAYNLNWKTLQPIKEKIEKALGIPFFIDNDANVAAL
GERWMGAGDNQPDVVFMTLGTGVGGGIVAEGKLLHGVAGAAGELGHITVDFDQPIACTCG
KKGCLETVASATGIVNLTRRYADEYEGDAALKRLIDDGEEVTAKTVFDLAKEGDDLALIV
YRNFSRYLGIACANIGSILNPSTIVIGGGVSAAGEFLLQGVQKVYDENTFPQVRTTTKLA
LATLGNDAGVIGAASLVLQ
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaaaagattatagggattgaccttggtggaacatctatcaagtttgcgatttta
actcaagagggagaaatccaagaaaaatggtctatcaagaccaatattttggacgaggga
agccatatcgtagatgatatgattgagtctattcaacatcgtttggacttgcttggattg
tctgctacagatttccgaggtattggaatgggatcacctggtgtggttgaccgtgaaaaa
gggactgttatcggtgcctacaacctaaactggaaaacccttcaaccaattaaagaaaag
attgaaaaagccttggggattccgttcttcattgacaatgatgccaacgtagctgctctt
ggtgagcgctggatgggtgctggtgacaaccaaccagacgttgtctttatgacacttggt
acaggtgttggtggtggtatcgtggcagaaggcaaattacttcacggtgttgctggtgcg
gcaggagaacttggtcacatcactgttgactttgaccaaccaatcgcatgtacttgcggt
aagaagggctgtttggagacagtagcttcagcaacagggattgtcaacttgactcgtcga
tatgcagatgaatacgagggcgatgcggccttgaaacgcttgatcgacgatggagaagaa
gtaactgccaaaactgtttttgacttggcaaaagagggagacgaccttgccttgatcgtt
taccgtaacttctcacgttacttgggaatcgcttgtgccaacatcggctcaatcctcaac
ccttcaacaatcgttatcggtggtggggtgtcagctgcgggagaattccttctacaaggt
gttcaaaaggtttatgacgaaaataccttcccacaagtacgcacaacaactaaactagct
cttgcaactctaggaaatgacgctggagttattggagcagcatcacttgtattgcaataa

DBGET integrated database retrieval system