KEGG   Streptococcus oralis: SOR_0961Help
Entry
SOR_0961          CDS       T01476                                 

Gene name
glgB
Definition
1,4-alpha-glucan branching enzyme (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
sor  Streptococcus oralis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:sor00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
935775..937670
Genome map
AA seq 631 aa AA seqDB search
MNNQEALRTFTTGENFHLQHYLGAHREEKNGEIGYTFRVWAPNAQAVHLVGDFTDWVENQ
IPMVRNEAGVWEVFTSQAQEGQIYKYHITRANGHQIMKIDPLAVYFEARPGTGAVLTNIR
EKKWKDGLWLARRKRLGFFERPVNIYEAHAGSWKRNPDGSPYTFSQLKDELIPYLVEMNY
THIEFMPLMAHPLGLSWGYQLMGYFAFEHSYGTPEEFQDFVEECHINNIGVIVDWVPGHF
TINDDALAYYDGTPTFEYQDHNKAHNYGWGALNFDLGKNEVQSFLISSIKFWIDSYHLDG
IRVDAVSNMLYLDYDNAPWTPNKDGGNLNYEGYYFLQRLNTVIKLAHPDIMMIAEESSSA
TKITGMKEMGGLGFDYKWNMGWMNDILRFYEEDPIYRKYDFNLVTFSFMYVFNENYLLPF
SHDEVVHGKKSMMHKMWGDRYNQFAGLRNLYTYQICHPGKKLLFMGSEYGQFLEWKSEEQ
LEWSNLEDPMNAKMKHFTSQLNQFYKDHRCLWEIDTSYDGIEIIDADNRDQSVLSFIRKG
KKDEMLVCVFNMAPVERKDFTIGLPVAGIYEEVWNTELEEWGGVWKEHNQTVQTQEGLWK
DYEQTLTFTLPAMGASIWKIKRRLKPAKKKE
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atgaataatcaagaagcattaagaacctttactacaggtgagaactttcacctccagcat
tatttaggagcgcatagagaggagaaaaacggagaaataggctatacctttagggtttgg
gccccaaatgcacaagcagttcatctagttggtgattttaccgattgggttgagaatcag
attcccatggttcgtaatgaagcaggtgtttgggaagtctttacgagtcaagctcaggaa
ggtcagatttataaatatcatatcacgcgtgcaaatggtcaccagattatgaagatcgat
ccgttggcagtttattttgaagctagaccgggtacaggagctgttttgaccaatatccgt
gaaaagaaatggaaagatggcctttggctagcacgtcgcaaacgtctgggatttttcgag
agaccagttaatatatatgaagcccatgcaggatcttggaagagaaatccagatggaagt
ccctatactttttcgcaactgaaagacgagttgattccatacttagttgagatgaactat
acacatattgagttcatgcctttaatggctcacccacttggattgagctggggctatcaa
cttatgggttactttgcttttgaacattcctatggtacacctgaggaattccaagatttc
gttgaagagtgtcatataaataatatcggtgttatcgtcgactgggttccaggtcatttc
actattaatgatgatgcattggcatattatgacggtacaccaacttttgaataccaagac
cacaacaaggctcataactatggttggggtgcgctgaattttgacctcgggaaaaatgag
gtccagtctttcctgatttcaagtattaaattttggattgattcttaccacttagatggt
attcgggtcgatgcagtgagcaatatgctgtatctagattatgataatgctccttggact
ccaaacaaagatggtggaaaccttaactacgagggttattatttccttcaacggttgaac
acagtgatcaagttagctcatccagatatcatgatgattgcagaagaaagttcatcagca
acaaagattactggtatgaaagaaatgggcggccttggatttgactataaatggaatatg
ggctggatgaacgacattctccgtttctacgaggaagatccgatttatcgtaagtatgac
tttaatctggtgactttcagctttatgtatgttttcaatgaaaactatctcctacctttt
tcacatgatgaagtggttcatggtaagaagagtatgatgcataagatgtggggagatcgc
tacaatcagttcgctggtctgcgcaacctctacacctatcaaatttgtcatccaggtaag
aaactcttgttcatgggtagtgagtacgggcaattcctagagtggaagtctgaggagcag
ttggaatggtctaatctagaagatccgatgaatgccaagatgaagcatttcacttcacaa
ctcaatcaattctataaagaccatcgctgtctgtgggaaattgatactagttatgatggt
atcgagattatcgatgctgataatagagatcagagtgtcctttcctttattcgtaagggc
aagaaagacgaaatgttagtctgtgtctttaacatggcaccagttgaacgtaaggacttt
acgattggtttacctgttgcaggtatttacgaagaagtttggaatacagaattagaagaa
tggggaggtgtgtggaaagagcacaatcaaacagttcagactcaagaaggcttatggaaa
gattatgagcagactttgacctttaccttgcctgccatgggagcaagcatctggaagatc
aagcgtcgtttgaaaccagctaagaaaaaagaataa

DBGET integrated database retrieval system